Married Malaysians Share How Much Ang Pow They Gave Out This Year For CNY

Chinese Family Goes Viral For Speaking Fluent ‘Kelate’ During CNY

'LV Wallet' Found On Ground Turns Out To Be Something Else

‘LV Wallet’ Found On Ground Turns Out To Be Something Else

<article>
<div class="each-segment">
    <a id="segment-502501" name="segment-502501" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on </i><i><a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a></i><i>, </i><i><a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a></i><i>, and </i><i><a target="_blank" rel="nofollow noopener" href="https://whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a></i><i>&nbsp;for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502568" name="segment-502568" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>A ginger cat found itself in a pickle after it stuck its head into a hole in an apartment building&#8217;s wall</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219875/daec.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219875" alt="" src="https://images.says.com/uploads/story_source/source_image/1219875/daec.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219876/8cfa.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219876" alt="" src="https://images.says.com/uploads/story_source/source_image/1219876/8cfa.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p><p>It was rescued by officers from the Civil Defence Force (APM) after they received an emergency call from a homeowner in Kota Kinabalu, Sabah.</p>
<p>The person reported that a cat was trapped in the wall of their home.</p>
<p>According to the APM&#8217;s <a href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l">Facebook post</a>, here is the sight that met their eyes:</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502569" name="segment-502569" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>To rescue the silly cat, the officers wore protective suits and used a power saw and other rescue tools to cut through the wall</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219877/9d21.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219877" alt="" src="https://images.says.com/uploads/story_source/source_image/1219877/9d21.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502582" name="segment-502582" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The cat seemed not at all embarrassed when it was successfully freed</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220010/dc06.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220010" alt="" src="https://images.says.com/uploads/story_source/source_image/1220010/dc06.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502583" name="segment-502583" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Amused netizens thanked the APM officers for saving the curious feline, and also laughed at the orange cat&#8217;s &#8220;typical behaviour&#8221;</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>&#8220;Oyens are really so naughty, hahaha. The oyen must&#8217;ve said, &#8216;Thank you, APM brothers for saving me&#8217;,&#8221; said a Facebook user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220012/12f3.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220012" alt="" src="https://images.says.com/uploads/story_source/source_image/1220012/12f3.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">Facebook</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>&#8220;Oyens must always find themselves in some kind of trouble, right? I wonder what was it doing to get stuck in there,&#8221; said a Twitter user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220014/c515.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220014" alt="" src="https://images.says.com/uploads/story_source/source_image/1220014/c515.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>Another laughed at the cat&#8217;s expression of defeat while it was stuck in the hole.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220016/2dc1.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220016" alt="" src="https://images.says.com/uploads/story_source/source_image/1220016/2dc1.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>While another said, &#8220;It looks so pitiful, but this is too funny.&#8221;</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220018/03d0.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220018" alt="" src="https://images.says.com/uploads/story_source/source_image/1220018/03d0.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502502" name="segment-502502" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The incident was also turned into a funny TikTok by APM:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@apmkotakinabalu/video/7336505779140267282" data-video-id="7336505779140267282" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@apmkotakinabalu" href="https://www.tiktok.com/@apmkotakinabalu?refer=embed" rel="noopener">@apmkotakinabalu</a> </p>
<p>Oyen yang terpaling penat, terpaling buat hal. Tapi syukur ada abam APM selamatkan oyen <a title="oyenbuathallagi" target="_blank" href="https://www.tiktok.com/tag/oyenbuathallagi?refer=embed" rel="noopener">#oyenbuathallagi</a> <a title="bukanoyenjebuatperangai" target="_blank" href="https://www.tiktok.com/tag/bukanoyenjebuatperangai?refer=embed" rel="noopener">#bukanoyenjebuatperangai</a> <a title="fyp" target="_blank" href="https://www.tiktok.com/tag/fyp?refer=embed" rel="noopener">#fyp</a> <a title="apmsabah" target="_blank" href="https://www.tiktok.com/tag/apmsabah?refer=embed" rel="noopener">#APMSABAH</a> <a title="apmkotakinabalu" target="_blank" href="https://www.tiktok.com/tag/apmkotakinabalu?refer=embed" rel="noopener">#APMKotaKinabalu</a> <a title="apmsanasini" target="_blank" href="https://www.tiktok.com/tag/apmsanasini?refer=embed" rel="noopener">#apmsanasini</a> <a title="fypage" target="_blank" href="https://www.tiktok.com/tag/fypage?refer=embed" rel="noopener">#fypage</a> <a title="angkatanpertahananawammalaysia" target="_blank" href="https://www.tiktok.com/tag/angkatanpertahananawammalaysia?refer=embed" rel="noopener">#angkatanpertahananawammalaysia</a> <a title="abamapm" target="_blank" href="https://www.tiktok.com/tag/abamapm?refer=embed" rel="noopener">#abamAPM</a> <a title="segakberseragam" target="_blank" href="https://www.tiktok.com/tag/segakberseragam?refer=embed" rel="noopener">#segakberseragam</a> <a title="pakaianberuniform" target="_blank" href="https://www.tiktok.com/tag/pakaianberuniform?refer=embed" rel="noopener">#pakaianberuniform</a> <a title="viral" target="_blank" href="https://www.tiktok.com/tag/viral?refer=embed" rel="noopener">#viral</a> <a title="videooftheday" target="_blank" href="https://www.tiktok.com/tag/videooftheday?refer=embed" rel="noopener">#videooftheday</a> </p>
<p> <a target="_blank" title=" original sound - Terpaling Majikan | Onies - ONIES MAYONIES " href="https://www.tiktok.com/music/original-sound-Terpaling-Majikan-Onies-7209979279713602330?refer=embed" rel="noopener"> original sound &#8211; Terpaling Majikan | Onies &#8211; ONIES MAYONIES </a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502570" name="segment-502570" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Here are other times cats have been rescued from odd situations:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/46094/c380.jpg&quot;);"><a href="https://says.com/my/fun/naughty-cat-got-its-head-stuck-in-a-hole-rescued-by-abang-bomba" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/naughty-cat-got-its-head-stuck-in-a-hole-rescued-by-abang-bomba" class="ga-curator-related">Naughty Cat That Got Its Head Stuck In A Hole Gets Rescued By Abang Bomba</a></h6>
<p>His face is my expression for the whole of 2020.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/62811/038b.jpg&quot;);"><a href="https://says.com/my/news/cat-survives-fall-from-6-storeys-high-car-window-smash-in-thailand" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/cat-survives-fall-from-6-storeys-high-car-window-smash-in-thailand" class="ga-curator-related">Cat Survives Smashing Into Car Window After 6-Storey Fall Without Breaking Any Bones</a></h6>
<p>The cat&#8217;s name is Shifu, like Master Shifu from &#8216;Kung Fu Panda&#8217;.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-502571" name="segment-502571" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Read more cute <a href="https://says.com/my/cat" target="_blank" rel="noopener">#cat</a> stories on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/67697/d5f3.jpg&quot;);"><a href="https://says.com/my/fun/cat-grabs-food-from-under-door" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-grabs-food-from-under-door" class="ga-curator-related">Funny Cat Grabs Food From Under Door Like He&#8217;s Been &#8220;Locked Up In Prison&#8221; For Years</a></h6>
<p>Just black cat things.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66770/01c1.jpg&quot;);"><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day</a></h6>
<p>Cutest thing you&#8217;ll see all year.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66654/cdf1.jpg&quot;);"><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">[VIDEO] M&#8217;sian Shares What Her Dad Is Up To After Retirement &#038; It&#8217;s Super Relatable</a></h6>
<p>It&#8217;s always the Asian parent who didn&#8217;t want a pet.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Oyen Gets Its Head Stuck In A Wall & Is Saved By The Civil Defence Force

These Cute Korean Grannies In Their 80s Formed A Hip-Hop Group & Write Rap Lyrics Together

<article>
<div class="each-segment">
    <a id="segment-502421" name="segment-502421" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>
</p>
<p><i>Follow us on </i><i><a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a></i><i>,&nbsp;</i><i><a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a></i><i>, and&nbsp;</i><i><a target="_blank" rel="nofollow noopener" href="https://whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a></i><i>&nbsp;for the latest stories and breaking news.<br /></i><i><br /><b>Note:</b> Video has been used with permission.</i><i><br /></i></p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502427" name="segment-502427" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The Burj Al Arab, Dubai&#8217;s iconic hotel, held a spectacular Lunar New Year dragon drone show that has left the Internet in awe</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>Dubai-based professional photographer and videographer pixtarami captured the incredible moment on his iPhone 15 Pro Max.</p>
<p>You can watch a snippet of it below:</p>
</div>
</div>
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="instagram-media" data-instgrm-permalink="https://www.instagram.com/reel/C3LT_jvSY-k/?utm_source=ig_embed&amp;utm_campaign=loading" data-instgrm-version="14" style=" background:#FFF; border:0; border-radius:3px; box-shadow:0 0 1px 0 rgba(0,0,0,0.5),0 1px 10px 0 rgba(0,0,0,0.15); margin: 1px; max-width:540px; min-width:326px; padding:0; width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);">
<div style="padding:16px;"> <a href="https://www.instagram.com/reel/C3LT_jvSY-k/?utm_source=ig_embed&amp;utm_campaign=loading" style=" background:#FFFFFF; line-height:0; padding:0 0; text-align:center; text-decoration:none; width:100%;" target="_blank" rel="noopener"> </p>
<div style=" display: flex; flex-direction: row; align-items: center;">
<div style="background-color: #F4F4F4; border-radius: 50%; flex-grow: 0; height: 40px; margin-right: 14px; width: 40px;"></div>
<div style="display: flex; flex-direction: column; flex-grow: 1; justify-content: center;">
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; margin-bottom: 6px; width: 100px;"></div>
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; width: 60px;"></div>
</div>
</div>
<div style="padding: 19% 0;"></div>
<div style="display:block; height:50px; margin:0 auto 12px; width:50px;"><svg width="50px" height="50px" viewBox="0 0 60 60" version="1.1" xmlns="https://www.w3.org/2000/svg" xmlns:xlink="https://www.w3.org/1999/xlink"><g stroke="none" stroke-width="1" fill="none" fill-rule="evenodd"><g transform="translate(-511.000000, -20.000000)" fill="#000000"><g><path d="M556.869,30.41 C554.814,30.41 553.148,32.076 553.148,34.131 C553.148,36.186 554.814,37.852 556.869,37.852 C558.924,37.852 560.59,36.186 560.59,34.131 C560.59,32.076 558.924,30.41 556.869,30.41 M541,60.657 C535.114,60.657 530.342,55.887 530.342,50 C530.342,44.114 535.114,39.342 541,39.342 C546.887,39.342 551.658,44.114 551.658,50 C551.658,55.887 546.887,60.657 541,60.657 M541,33.886 C532.1,33.886 524.886,41.1 524.886,50 C524.886,58.899 532.1,66.113 541,66.113 C549.9,66.113 557.115,58.899 557.115,50 C557.115,41.1 549.9,33.886 541,33.886 M565.378,62.101 C565.244,65.022 564.756,66.606 564.346,67.663 C563.803,69.06 563.154,70.057 562.106,71.106 C561.058,72.155 560.06,72.803 558.662,73.347 C557.607,73.757 556.021,74.244 553.102,74.378 C549.944,74.521 548.997,74.552 541,74.552 C533.003,74.552 532.056,74.521 528.898,74.378 C525.979,74.244 524.393,73.757 523.338,73.347 C521.94,72.803 520.942,72.155 519.894,71.106 C518.846,70.057 518.197,69.06 517.654,67.663 C517.244,66.606 516.755,65.022 516.623,62.101 C516.479,58.943 516.448,57.996 516.448,50 C516.448,42.003 516.479,41.056 516.623,37.899 C516.755,34.978 517.244,33.391 517.654,32.338 C518.197,30.938 518.846,29.942 519.894,28.894 C520.942,27.846 521.94,27.196 523.338,26.654 C524.393,26.244 525.979,25.756 528.898,25.623 C532.057,25.479 533.004,25.448 541,25.448 C548.997,25.448 549.943,25.479 553.102,25.623 C556.021,25.756 557.607,26.244 558.662,26.654 C560.06,27.196 561.058,27.846 562.106,28.894 C563.154,29.942 563.803,30.938 564.346,32.338 C564.756,33.391 565.244,34.978 565.378,37.899 C565.522,41.056 565.552,42.003 565.552,50 C565.552,57.996 565.522,58.943 565.378,62.101 M570.82,37.631 C570.674,34.438 570.167,32.258 569.425,30.349 C568.659,28.377 567.633,26.702 565.965,25.035 C564.297,23.368 562.623,22.342 560.652,21.575 C558.743,20.834 556.562,20.326 553.369,20.18 C550.169,20.033 549.148,20 541,20 C532.853,20 531.831,20.033 528.631,20.18 C525.438,20.326 523.257,20.834 521.349,21.575 C519.376,22.342 517.703,23.368 516.035,25.035 C514.368,26.702 513.342,28.377 512.574,30.349 C511.834,32.258 511.326,34.438 511.181,37.631 C511.035,40.831 511,41.851 511,50 C511,58.147 511.035,59.17 511.181,62.369 C511.326,65.562 511.834,67.743 512.574,69.651 C513.342,71.625 514.368,73.296 516.035,74.965 C517.703,76.634 519.376,77.658 521.349,78.425 C523.257,79.167 525.438,79.673 528.631,79.82 C531.831,79.965 532.853,80.001 541,80.001 C549.148,80.001 550.169,79.965 553.369,79.82 C556.562,79.673 558.743,79.167 560.652,78.425 C562.623,77.658 564.297,76.634 565.965,74.965 C567.633,73.296 568.659,71.625 569.425,69.651 C570.167,67.743 570.674,65.562 570.82,62.369 C570.966,59.17 571,58.147 571,50 C571,41.851 570.966,40.831 570.82,37.631"></path></g></g></g></svg></div>
<div style="padding-top: 8px;">
<div style=" color:#3897f0; font-family:Arial,sans-serif; font-size:14px; font-style:normal; font-weight:550; line-height:18px;">View this post on Instagram</div>
</div>
<div style="padding: 12.5% 0;"></div>
<div style="display: flex; flex-direction: row; margin-bottom: 14px; align-items: center;">
<div>
<div style="background-color: #F4F4F4; border-radius: 50%; height: 12.5px; width: 12.5px; transform: translateX(0px) translateY(7px);"></div>
<div style="background-color: #F4F4F4; height: 12.5px; transform: rotate(-45deg) translateX(3px) translateY(1px); width: 12.5px; flex-grow: 0; margin-right: 14px; margin-left: 2px;"></div>
<div style="background-color: #F4F4F4; border-radius: 50%; height: 12.5px; width: 12.5px; transform: translateX(9px) translateY(-18px);"></div>
</div>
<div style="margin-left: 8px;">
<div style=" background-color: #F4F4F4; border-radius: 50%; flex-grow: 0; height: 20px; width: 20px;"></div>
<div style=" width: 0; height: 0; border-top: 2px solid transparent; border-left: 6px solid #f4f4f4; border-bottom: 2px solid transparent; transform: translateX(16px) translateY(-4px) rotate(30deg)"></div>
</div>
<div style="margin-left: auto;">
<div style=" width: 0px; border-top: 8px solid #F4F4F4; border-right: 8px solid transparent; transform: translateY(16px);"></div>
<div style=" background-color: #F4F4F4; flex-grow: 0; height: 12px; width: 16px; transform: translateY(-4px);"></div>
<div style=" width: 0; height: 0; border-top: 8px solid #F4F4F4; border-left: 8px solid transparent; transform: translateY(-4px) translateX(8px);"></div>
</div>
</div>
<div style="display: flex; flex-direction: column; flex-grow: 1; justify-content: center; margin-bottom: 24px;">
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; margin-bottom: 6px; width: 224px;"></div>
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; width: 144px;"></div>
</div>
<p></a></p>
<p style=" color:#c9c8cd; font-family:Arial,sans-serif; font-size:14px; line-height:17px; margin-bottom:0; margin-top:8px; overflow:hidden; padding:8px 0 7px; text-align:center; text-overflow:ellipsis; white-space:nowrap;"><a href="https://www.instagram.com/reel/C3LT_jvSY-k/?utm_source=ig_embed&amp;utm_campaign=loading" style=" color:#c9c8cd; font-family:Arial,sans-serif; font-size:14px; font-style:normal; font-weight:normal; line-height:17px; text-decoration:none;" target="_blank" rel="noopener">A post shared by Rami Dibo (@pixtarami)</a></p>
</div>
</blockquote>
<p> <script async src="//www.instagram.com/embed.js"></script></div>
</div>
<div class="text">
<div class="">
<p>
</p>
</p>
</p>
</p>
</p>
<p>The show, held on Sunday, 11 February, drew a crowd to witness the 300m-dragon circling the building.</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502448" name="segment-502448" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>A whopping 1,500 drones were used in the show, which reportedly broke a Guinness World Record as the first drone show to circle a building</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219649/19a9.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219649" alt="" src="https://images.says.com/uploads/story_source/source_image/1219649/19a9.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C3LT_jvSY-k/" rel="noopener">@pixtarami (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>
</p>
</p>
</p>
</p>
</p>
<p>According to New Zealand media outlet, <a target="_blank" rel="nofollow noopener" href="https://www.stuff.co.nz/travel/350179057/chinese-new-year-dragon-breaks-world-record">Stuff</a>, nine months of planning went into the drone formation, resulting in this mesmerising show, which many say is even better than fireworks.</p>
<p>As the dragon gracefully circled the building, it even  transitioned through a spectrum of colours, from blue to green, red, and yellow hues.﻿</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502460" name="segment-502460" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Dubai wasn&#8217;t the only place that celebrated the new year with a drone show</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>
</p>
</p>
</p>
</p>
</p>
<p>Marina Bay Sands in Singapore illuminated the skies with <i>&#8216;The Legend of the Dragon Gate: Drone Show&#8217;</i>, a stunning display that drew massive crowds and also featured 1,500 drones.</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="text">
<div class="">
<p>Some 3,000 drones also formed a dragon over Tianfu International Convention Centre in Chengdu, China, on 7 February.</p>
<p>South Korea celebrated their new year earlier this year with a dazzling display of drones in the shape of a dragon flying over <a href="https://www.instagram.com/p/C1jmC2vPVsZ/?utm_source=ig_embed&amp;ig_rid=7b27db67-1319-459a-9aac-0389541858f8">Gwangalli Beach</a>.&nbsp;</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219698/3de5.jpeg" target="" class="imgwrap colorbox-image cboxElement" title="Drone show in Chengdu, China." rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219698" alt="Drone show in Chengdu, China." src="https://images.says.com/uploads/story_source/source_image/1219698/3de5.jpeg"> </a>
                </div>
<p class="img-caption">Drone show in Chengdu, China.</p>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://news.cgtn.com/news/2024-02-08/Stunning-drone-show-lights-up-the-sky-in-Chengdu-1r1EFMkGe6A/p.html" rel="noopener">CFP/CGTN</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219720/fcc5.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219720" alt="" src="https://images.says.com/uploads/story_source/source_image/1219720/fcc5.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://cnalifestyle.channelnewsasia.com/entertainment/dragon-drone-show-marina-bay-waterfront-february-383896" rel="noopener">Marina Bay Sands/CNA</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502468" name="segment-502468" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Back in 2020, Malaysia also held its own drone show at Dataran Merdeka:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/41639/884e.jpg&quot;);"><a href="https://says.com/my/tech/did-you-watch-the-new-year-s-eve-drone-show-in-kl-here-are-five-fun-facts-about-it" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/tech/did-you-watch-the-new-year-s-eve-drone-show-in-kl-here-are-five-fun-facts-about-it" class="ga-curator-related">Did You Watch The NYE Drone Show In KL? Here Are 5 Fun Facts About It</a></h6>
<p>The New Year&#8217;s Eve celebration saw 300 drones performing over Dataran Merdeka on 31 December.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-502469" name="segment-502469" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Catch up on more CNY-related stories on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/67603/4d16.png&quot;);"><a href="https://says.com/my/lifestyle/kwai-chai-hong-art-installation-chinese-new-year" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/kwai-chai-hong-art-installation-chinese-new-year" class="ga-curator-related">No Plans This Weekend? You&#8217;ll Wanna Check Out Kwai Chai Hong&#8217;s Mahjong Art Installation</a></h6>
<p>Kwai Chai Hong will be open from 9am to 12am daily.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/67643/4923.jpg&quot;);"><a href="https://says.com/my/fun/boss-rm10000-employees-cny-blindfolded-money-scoop-game" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/boss-rm10000-employees-cny-blindfolded-money-scoop-game" class="ga-curator-related">[VIDEO] Boss Treats Employees To RM10,000 CNY Bonus In Blindfolded Money-Scooping Game</a></h6>
<p>The company said they&#8217;re looking to hire. 😉</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/67698/8282.png&quot;);"><a href="https://says.com/my/fun/ang-pow-money-received-cny" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/ang-pow-money-received-cny" class="ga-curator-related">Malaysian Adults Share How Much Ang Pow They Received For Chinese New Year So Far</a></h6>
<p>Just for fun. Don&#8217;t so serious.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://storage.googleapis.com/says_image_uploader/uploads/temp/Your_paragraph_text__95_.png&quot;);"><a href="https://says.com/my/news/authorised-firecrackers-for-festive-seasons" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/authorised-firecrackers-for-festive-seasons" class="ga-curator-related">Did You Know There Are 45 Types Of Firecrackers That Are Authorised For Sale In Malaysia?</a></h6>
<p>Also, purchasing firecrackers online is an offense under Section 8 of the Explosives Substance Act 1957, and can lead to jail time and/or a fine.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Epic Dragon Formed With 1,500 Drones Is The First Drone Show To Fly Around A Building

This Year 1 Maths Problem Has Parents Scratching Their Heads Over The Correct Answer

<article>
<div class="each-segment">
    <a id="segment-502224" name="segment-502224" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>, <a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and <a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a> for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502225" name="segment-502225" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Want to get rid of cockroaches in your vehicle, but don&#8217;t want to <a href="https://says.com/my/lifestyle/malaysian-shares-easy-hack-to-get-rid-of-cockroaches-in-your-car" target="_blank" rel="noopener">buy any product</a> to get the job done?</p>
<p>Well, this Malaysian has shown a way to use just four household items to attract and trap the pesty insects in your car.</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>In an <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/p/C0c9HLjglea/">Instagram Reel</a> posted in December last year, Hornson Lui shared that it is not uncommon to find cockroaches in cars.</p>
<p>To eradicate all of the cockroaches in cars, Lui said one would just have to prepare the following:<br />– a wide container,<br />– some oil,<br />– margarine, and<br />– some crackers</p>
<p>He said to put the three ingredients in the uncovered container, and leave it on the floorboard of a car.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219229/bb73.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219229" alt="" src="https://images.says.com/uploads/story_source/source_image/1219229/bb73.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C0c9HLjglea/" rel="noopener">@hornson1015 (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502235" name="segment-502235" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Lui suggested leaving the DIY trap in the vehicle overnight and checking the results the following morning</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>At the end of the one-minute video, Lui demonstrated that his simple hack had caught over a dozen cockroaches.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219230/5681.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219230" alt="" src="https://images.says.com/uploads/story_source/source_image/1219230/5681.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C0c9HLjglea/" rel="noopener">@hornson1015 (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502242" name="segment-502242" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>At the time of writing, his video has garnered over 1.4 million views, with hundreds of netizens expressing fascination with his straightforward approach to eliminating cockroaches</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>&#8220;Why would the cockroaches die from eating [the ingredients], or they couldn&#8217;t escape [from the container]?&#8221; asked an Instagram user. Another user explained that the cockroaches were trapped to death by the oil, and they were unable to even reach the crackers.</p>
<p>&#8220;Let&#8217;s try this,&#8221; said a netizen, tagging a friend.</p>
<p>Meanwhile, a netizen quipped, &#8220;Don&#8217;t waste the biscuits. [They&#8217;re] still edible.&#8221;</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219232/9653.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219232" alt="" src="https://images.says.com/uploads/story_source/source_image/1219232/9653.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="null" rel="noopener">null</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502236" name="segment-502236" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Watch the video below:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="instagram-media" data-instgrm-permalink="https://www.instagram.com/reel/C0c9HLjglea/?utm_source=ig_embed&amp;utm_campaign=loading" data-instgrm-version="14" style=" background:#FFF; border:0; border-radius:3px; box-shadow:0 0 1px 0 rgba(0,0,0,0.5),0 1px 10px 0 rgba(0,0,0,0.15); margin: 1px; max-width:540px; min-width:326px; padding:0; width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);">
<div style="padding:16px;"> <a href="https://www.instagram.com/reel/C0c9HLjglea/?utm_source=ig_embed&amp;utm_campaign=loading" style=" background:#FFFFFF; line-height:0; padding:0 0; text-align:center; text-decoration:none; width:100%;" target="_blank" rel="noopener"> </p>
<div style=" display: flex; flex-direction: row; align-items: center;">
<div style="background-color: #F4F4F4; border-radius: 50%; flex-grow: 0; height: 40px; margin-right: 14px; width: 40px;"></div>
<div style="display: flex; flex-direction: column; flex-grow: 1; justify-content: center;">
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; margin-bottom: 6px; width: 100px;"></div>
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; width: 60px;"></div>
</div>
</div>
<div style="padding: 19% 0;"></div>
<div style="display:block; height:50px; margin:0 auto 12px; width:50px;"><svg width="50px" height="50px" viewBox="0 0 60 60" version="1.1" xmlns="https://www.w3.org/2000/svg" xmlns:xlink="https://www.w3.org/1999/xlink"><g stroke="none" stroke-width="1" fill="none" fill-rule="evenodd"><g transform="translate(-511.000000, -20.000000)" fill="#000000"><g><path d="M556.869,30.41 C554.814,30.41 553.148,32.076 553.148,34.131 C553.148,36.186 554.814,37.852 556.869,37.852 C558.924,37.852 560.59,36.186 560.59,34.131 C560.59,32.076 558.924,30.41 556.869,30.41 M541,60.657 C535.114,60.657 530.342,55.887 530.342,50 C530.342,44.114 535.114,39.342 541,39.342 C546.887,39.342 551.658,44.114 551.658,50 C551.658,55.887 546.887,60.657 541,60.657 M541,33.886 C532.1,33.886 524.886,41.1 524.886,50 C524.886,58.899 532.1,66.113 541,66.113 C549.9,66.113 557.115,58.899 557.115,50 C557.115,41.1 549.9,33.886 541,33.886 M565.378,62.101 C565.244,65.022 564.756,66.606 564.346,67.663 C563.803,69.06 563.154,70.057 562.106,71.106 C561.058,72.155 560.06,72.803 558.662,73.347 C557.607,73.757 556.021,74.244 553.102,74.378 C549.944,74.521 548.997,74.552 541,74.552 C533.003,74.552 532.056,74.521 528.898,74.378 C525.979,74.244 524.393,73.757 523.338,73.347 C521.94,72.803 520.942,72.155 519.894,71.106 C518.846,70.057 518.197,69.06 517.654,67.663 C517.244,66.606 516.755,65.022 516.623,62.101 C516.479,58.943 516.448,57.996 516.448,50 C516.448,42.003 516.479,41.056 516.623,37.899 C516.755,34.978 517.244,33.391 517.654,32.338 C518.197,30.938 518.846,29.942 519.894,28.894 C520.942,27.846 521.94,27.196 523.338,26.654 C524.393,26.244 525.979,25.756 528.898,25.623 C532.057,25.479 533.004,25.448 541,25.448 C548.997,25.448 549.943,25.479 553.102,25.623 C556.021,25.756 557.607,26.244 558.662,26.654 C560.06,27.196 561.058,27.846 562.106,28.894 C563.154,29.942 563.803,30.938 564.346,32.338 C564.756,33.391 565.244,34.978 565.378,37.899 C565.522,41.056 565.552,42.003 565.552,50 C565.552,57.996 565.522,58.943 565.378,62.101 M570.82,37.631 C570.674,34.438 570.167,32.258 569.425,30.349 C568.659,28.377 567.633,26.702 565.965,25.035 C564.297,23.368 562.623,22.342 560.652,21.575 C558.743,20.834 556.562,20.326 553.369,20.18 C550.169,20.033 549.148,20 541,20 C532.853,20 531.831,20.033 528.631,20.18 C525.438,20.326 523.257,20.834 521.349,21.575 C519.376,22.342 517.703,23.368 516.035,25.035 C514.368,26.702 513.342,28.377 512.574,30.349 C511.834,32.258 511.326,34.438 511.181,37.631 C511.035,40.831 511,41.851 511,50 C511,58.147 511.035,59.17 511.181,62.369 C511.326,65.562 511.834,67.743 512.574,69.651 C513.342,71.625 514.368,73.296 516.035,74.965 C517.703,76.634 519.376,77.658 521.349,78.425 C523.257,79.167 525.438,79.673 528.631,79.82 C531.831,79.965 532.853,80.001 541,80.001 C549.148,80.001 550.169,79.965 553.369,79.82 C556.562,79.673 558.743,79.167 560.652,78.425 C562.623,77.658 564.297,76.634 565.965,74.965 C567.633,73.296 568.659,71.625 569.425,69.651 C570.167,67.743 570.674,65.562 570.82,62.369 C570.966,59.17 571,58.147 571,50 C571,41.851 570.966,40.831 570.82,37.631"></path></g></g></g></svg></div>
<div style="padding-top: 8px;">
<div style=" color:#3897f0; font-family:Arial,sans-serif; font-size:14px; font-style:normal; font-weight:550; line-height:18px;">View this post on Instagram</div>
</div>
<div style="padding: 12.5% 0;"></div>
<div style="display: flex; flex-direction: row; margin-bottom: 14px; align-items: center;">
<div>
<div style="background-color: #F4F4F4; border-radius: 50%; height: 12.5px; width: 12.5px; transform: translateX(0px) translateY(7px);"></div>
<div style="background-color: #F4F4F4; height: 12.5px; transform: rotate(-45deg) translateX(3px) translateY(1px); width: 12.5px; flex-grow: 0; margin-right: 14px; margin-left: 2px;"></div>
<div style="background-color: #F4F4F4; border-radius: 50%; height: 12.5px; width: 12.5px; transform: translateX(9px) translateY(-18px);"></div>
</div>
<div style="margin-left: 8px;">
<div style=" background-color: #F4F4F4; border-radius: 50%; flex-grow: 0; height: 20px; width: 20px;"></div>
<div style=" width: 0; height: 0; border-top: 2px solid transparent; border-left: 6px solid #f4f4f4; border-bottom: 2px solid transparent; transform: translateX(16px) translateY(-4px) rotate(30deg)"></div>
</div>
<div style="margin-left: auto;">
<div style=" width: 0px; border-top: 8px solid #F4F4F4; border-right: 8px solid transparent; transform: translateY(16px);"></div>
<div style=" background-color: #F4F4F4; flex-grow: 0; height: 12px; width: 16px; transform: translateY(-4px);"></div>
<div style=" width: 0; height: 0; border-top: 8px solid #F4F4F4; border-left: 8px solid transparent; transform: translateY(-4px) translateX(8px);"></div>
</div>
</div>
<div style="display: flex; flex-direction: column; flex-grow: 1; justify-content: center; margin-bottom: 24px;">
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; margin-bottom: 6px; width: 224px;"></div>
<div style=" background-color: #F4F4F4; border-radius: 4px; flex-grow: 0; height: 14px; width: 144px;"></div>
</div>
<p></a></p>
<p style=" color:#c9c8cd; font-family:Arial,sans-serif; font-size:14px; line-height:17px; margin-bottom:0; margin-top:8px; overflow:hidden; padding:8px 0 7px; text-align:center; text-overflow:ellipsis; white-space:nowrap;"><a href="https://www.instagram.com/reel/C0c9HLjglea/?utm_source=ig_embed&amp;utm_campaign=loading" style=" color:#c9c8cd; font-family:Arial,sans-serif; font-size:14px; font-style:normal; font-weight:normal; line-height:17px; text-decoration:none;" target="_blank" rel="noopener">A post shared by Hornson Lui (@hornson1015)</a></p>
</div>
</blockquote>
<p> <script async src="//www.instagram.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502243" name="segment-502243" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>If you prefer using a spray to lure out and kill cockroaches in your car, check out these articles:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/47582/ba20.jpg&quot;);"><a href="https://says.com/my/lifestyle/malaysian-shares-easy-hack-to-get-rid-of-cockroaches-in-your-car" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/malaysian-shares-easy-hack-to-get-rid-of-cockroaches-in-your-car" class="ga-curator-related">Malaysian Dad Shares Easy Hack To Kill All The Cockroaches Lurking In Your Car</a></h6>
<p>A few other people said it works!</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/56946/0d59.jpg&quot;);"><a href="https://says.com/my/lifestyle/viral-spray-kill-cockroaches-in-your-car-within-minutes" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/viral-spray-kill-cockroaches-in-your-car-within-minutes" class="ga-curator-related">[VIDEO] This Viral Spray Claims To Lure And Kill Cockroaches In Your Car Within 10 Minutes</a></h6>
<p>So many baby roaches!</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-502244" name="segment-502244" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Meanwhile, read this article to learn how to avoid attracting cockroaches to your home:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/30790/4276.jpg&quot;);"><a href="https://says.com/my/lifestyle/why-cockroach-like-to-come-to-your-house-or-live-in-your-car" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/why-cockroach-like-to-come-to-your-house-or-live-in-your-car" class="ga-curator-related">Why Cockroaches Are Attracted To Your Home Even When It&#8217;s Relatively Clean</a></h6>
<p>Please don&#8217;t fly.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Malaysian Shares Simple Trick To Catch Cockroaches In Cars Using 4 Household Items

Malaysian Adults Share How Much Ang Pow They Received For Chinese New Year So Far

<article>
<div class="each-segment">
    <a id="segment-502106" name="segment-502106" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>
<p>
<p><p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>,&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502107" name="segment-502107" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Cats do the darnedest things sometimes and this little black fellow is no exception</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>A <a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830">TikTok</a> posted by Heaven Jirak has been going viral after she showed how her cat gets food from her.</p>
<p>In the video, Heaven is seen putting a plate of cat food on the floor in front of a door. </p>
<p>Before she can even let go of the plate, a black paw slides under the door and quickly grabs the plate from the other side in less than a second.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218967/8306.gif" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218967" alt="" src="https://images.says.com/uploads/story_source/source_image/1218967/8306.gif"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">@heaven.like.the.place (TikTok)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502111" name="segment-502111" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The video has the Internet in stitches, with many likening the cat&#8217;s antics to that of a prisoner locked away in confinement</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218977/f7e4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218977" alt="" src="https://images.says.com/uploads/story_source/source_image/1218977/f7e4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218978/0390.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218978" alt="" src="https://images.says.com/uploads/story_source/source_image/1218978/0390.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218979/a697.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218979" alt="" src="https://images.says.com/uploads/story_source/source_image/1218979/a697.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218980/80de.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218980" alt="" src="https://images.says.com/uploads/story_source/source_image/1218980/80de.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218981/3ad4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218981" alt="" src="https://images.says.com/uploads/story_source/source_image/1218981/3ad4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218982/6653.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218982" alt="" src="https://images.says.com/uploads/story_source/source_image/1218982/6653.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218983/e00b.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218983" alt="" src="https://images.says.com/uploads/story_source/source_image/1218983/e00b.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>After one person pointed out that she could imagine the &#8220;jailbird&#8221; just waiting patiently on the other end for his food, Heaven shared a video of the cat&#8217;s point-of-view.</p>
</div>
</div>
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7334440173205310763" data-video-id="7334440173205310763" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>Replying to @Side of Sunny impatiently waiting</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7334440299365780267?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="text">
<div class="">
<p>He indeed waits patiently and immediately snatches the plate from her as soon he hears it coming.</p>
<p>Watch his POV below:﻿</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502120" name="segment-502120" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Heaven revealed that her cat&#8217;s name is Bill and he is one of her four cats at home</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>Speaking to SAYS, she said she got Bill when he was just nine weeks old as a wedding gift from her husband. Bill will turn one next month. </p>
<p>She explained that Bill is &#8220;fed like a solitary inmate&#8221; because he won&#8217;t let her other cats eat, and he sometimes smacks the bowl out of her hands. </p>
<p>So far, this method seems to be effective, as she mentioned that she has tried slow feeders in the past, but Bill would just bite the plastic out of anger. &#8220;He&#8217;s just a little piggy and steals food,&#8221; she added.</p>
<p>Here&#8217;s a close-up of Bill:</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219004/30b9.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219004" alt="" src="https://images.says.com/uploads/story_source/source_image/1219004/30b9.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7334085421506366763" rel="noopener">@heaven.like.the.place (TikTok)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>
</p>
</p>
</p>
</p>
</p>
<p>Bill also often behaves like the &#8216;ultimate youngest child&#8217; by instigating conflicts with the other cats, then crying out for help when faced with consequences, she said, providing a video as proof.</p>
<p>You can watch it below:</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7334776816500002090" data-video-id="7334776816500002090" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>bill is the ultimate youngest child, starts shit then screams for help when there are consequences.</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7334777002487974699?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502112" name="segment-502112" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>As naughty as Bill is though, he does have some tricks up his paw</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7308444701156232491" data-video-id="7308444701156232491" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>we call this one kill bill <a title="catsoftiktok" target="_blank" href="https://www.tiktok.com/tag/catsoftiktok?refer=embed" rel="noopener">#catsoftiktok</a> <a title="cat" target="_blank" href="https://www.tiktok.com/tag/cat?refer=embed" rel="noopener">#cat</a> <a title="britishshorthair" target="_blank" href="https://www.tiktok.com/tag/britishshorthair?refer=embed" rel="noopener">#britishshorthair</a> </p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7308444779703110446?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="text">
<div class="">
<p>When she pretends to hold Bill at &#8216;gunpoint&#8217; with her fingers and &#8216;shoots&#8217;, Bill can flop over as if he has just been shot.</p>
<p>She refers to the trick shot as <i>Kill Bill</i>.&nbsp;</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502113" name="segment-502113" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Watch the video of how she feeds him below:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" data-video-id="7333745089052822830" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>this is the easiest way to feed our fouth and craziest cat</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7333745214325312302?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502121" name="segment-502121" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Cat antics will never stop being funny:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66770/01c1.jpg&quot;);"><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day</a></h6>
<p>Cutest thing you&#8217;ll see all year.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/63726/1b55.jpg&quot;);"><a href="https://says.com/my/fun/cat-goes-bald-because-its-friend-keeps-licking-its-head" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-goes-bald-because-its-friend-keeps-licking-its-head" class="ga-curator-related">Cat Goes Bald Because Its Friend Keeps Licking Its Head So Owner Comes Up With Solution</a></h6>
<p>Appropriate solution.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/55920/319c.jpg&quot;);"><a href="https://says.com/my/fun/hilariously-cute-curious-cat-staring-into-its-owner-s-new-cctv" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/hilariously-cute-curious-cat-staring-into-its-owner-s-new-cctv" class="ga-curator-related">Hilariously Cute, &#8216;Kepoh&#8217; Cat Goes Viral For Continuously Staring Into Owner&#8217;s New CCTV</a></h6>
<p>The cutest staredown.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/51246/3201.jpg&quot;);"><a href="https://says.com/my/fun/cat-goes-viral-for-looking-like-dad-who-fall-asleep-on-the-couch" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-goes-viral-for-looking-like-dad-who-fall-asleep-on-the-couch" class="ga-curator-related">Cat Goes Viral For Looking Like A Dad Who Fell Asleep On The Couch</a></h6>
<p>Floof.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/52461/5cc7.jpg&quot;);"><a href="https://says.com/my/fun/malaysian-viral-crochet-cat-hats" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/malaysian-viral-crochet-cat-hats" class="ga-curator-related">Malaysian Crochets And Sells Cat Hats &#038; These Review Photos Are Giving Me Life</a></h6>
<p>The Internet loves them, Bob tolerates them.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Funny Cat Grabs Food From Under Door Like He's Been "Locked Up In Prison" For Years