These Cat & Dog Cafés In Johor Bahru Have The Cutest Floofs To Sayang

<article>
<div class="each-segment">
    <a id="segment-502501" name="segment-502501" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on </i><i><a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a></i><i>, </i><i><a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a></i><i>, and </i><i><a target="_blank" rel="nofollow noopener" href="https://whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a></i><i>&nbsp;for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502568" name="segment-502568" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>A ginger cat found itself in a pickle after it stuck its head into a hole in an apartment building&#8217;s wall</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219875/daec.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219875" alt="" src="https://images.says.com/uploads/story_source/source_image/1219875/daec.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219876/8cfa.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219876" alt="" src="https://images.says.com/uploads/story_source/source_image/1219876/8cfa.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p><p>It was rescued by officers from the Civil Defence Force (APM) after they received an emergency call from a homeowner in Kota Kinabalu, Sabah.</p>
<p>The person reported that a cat was trapped in the wall of their home.</p>
<p>According to the APM&#8217;s <a href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l">Facebook post</a>, here is the sight that met their eyes:</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502569" name="segment-502569" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>To rescue the silly cat, the officers wore protective suits and used a power saw and other rescue tools to cut through the wall</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219877/9d21.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219877" alt="" src="https://images.says.com/uploads/story_source/source_image/1219877/9d21.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502582" name="segment-502582" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The cat seemed not at all embarrassed when it was successfully freed</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220010/dc06.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220010" alt="" src="https://images.says.com/uploads/story_source/source_image/1220010/dc06.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502583" name="segment-502583" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Amused netizens thanked the APM officers for saving the curious feline, and also laughed at the orange cat&#8217;s &#8220;typical behaviour&#8221;</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>&#8220;Oyens are really so naughty, hahaha. The oyen must&#8217;ve said, &#8216;Thank you, APM brothers for saving me&#8217;,&#8221; said a Facebook user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220012/12f3.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220012" alt="" src="https://images.says.com/uploads/story_source/source_image/1220012/12f3.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">Facebook</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>&#8220;Oyens must always find themselves in some kind of trouble, right? I wonder what was it doing to get stuck in there,&#8221; said a Twitter user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220014/c515.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220014" alt="" src="https://images.says.com/uploads/story_source/source_image/1220014/c515.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>Another laughed at the cat&#8217;s expression of defeat while it was stuck in the hole.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220016/2dc1.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220016" alt="" src="https://images.says.com/uploads/story_source/source_image/1220016/2dc1.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>While another said, &#8220;It looks so pitiful, but this is too funny.&#8221;</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220018/03d0.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220018" alt="" src="https://images.says.com/uploads/story_source/source_image/1220018/03d0.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502502" name="segment-502502" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The incident was also turned into a funny TikTok by APM:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@apmkotakinabalu/video/7336505779140267282" data-video-id="7336505779140267282" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@apmkotakinabalu" href="https://www.tiktok.com/@apmkotakinabalu?refer=embed" rel="noopener">@apmkotakinabalu</a> </p>
<p>Oyen yang terpaling penat, terpaling buat hal. Tapi syukur ada abam APM selamatkan oyen <a title="oyenbuathallagi" target="_blank" href="https://www.tiktok.com/tag/oyenbuathallagi?refer=embed" rel="noopener">#oyenbuathallagi</a> <a title="bukanoyenjebuatperangai" target="_blank" href="https://www.tiktok.com/tag/bukanoyenjebuatperangai?refer=embed" rel="noopener">#bukanoyenjebuatperangai</a> <a title="fyp" target="_blank" href="https://www.tiktok.com/tag/fyp?refer=embed" rel="noopener">#fyp</a> <a title="apmsabah" target="_blank" href="https://www.tiktok.com/tag/apmsabah?refer=embed" rel="noopener">#APMSABAH</a> <a title="apmkotakinabalu" target="_blank" href="https://www.tiktok.com/tag/apmkotakinabalu?refer=embed" rel="noopener">#APMKotaKinabalu</a> <a title="apmsanasini" target="_blank" href="https://www.tiktok.com/tag/apmsanasini?refer=embed" rel="noopener">#apmsanasini</a> <a title="fypage" target="_blank" href="https://www.tiktok.com/tag/fypage?refer=embed" rel="noopener">#fypage</a> <a title="angkatanpertahananawammalaysia" target="_blank" href="https://www.tiktok.com/tag/angkatanpertahananawammalaysia?refer=embed" rel="noopener">#angkatanpertahananawammalaysia</a> <a title="abamapm" target="_blank" href="https://www.tiktok.com/tag/abamapm?refer=embed" rel="noopener">#abamAPM</a> <a title="segakberseragam" target="_blank" href="https://www.tiktok.com/tag/segakberseragam?refer=embed" rel="noopener">#segakberseragam</a> <a title="pakaianberuniform" target="_blank" href="https://www.tiktok.com/tag/pakaianberuniform?refer=embed" rel="noopener">#pakaianberuniform</a> <a title="viral" target="_blank" href="https://www.tiktok.com/tag/viral?refer=embed" rel="noopener">#viral</a> <a title="videooftheday" target="_blank" href="https://www.tiktok.com/tag/videooftheday?refer=embed" rel="noopener">#videooftheday</a> </p>
<p> <a target="_blank" title=" original sound - Terpaling Majikan | Onies - ONIES MAYONIES " href="https://www.tiktok.com/music/original-sound-Terpaling-Majikan-Onies-7209979279713602330?refer=embed" rel="noopener"> original sound &#8211; Terpaling Majikan | Onies &#8211; ONIES MAYONIES </a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502570" name="segment-502570" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Here are other times cats have been rescued from odd situations:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/46094/c380.jpg&quot;);"><a href="https://says.com/my/fun/naughty-cat-got-its-head-stuck-in-a-hole-rescued-by-abang-bomba" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/naughty-cat-got-its-head-stuck-in-a-hole-rescued-by-abang-bomba" class="ga-curator-related">Naughty Cat That Got Its Head Stuck In A Hole Gets Rescued By Abang Bomba</a></h6>
<p>His face is my expression for the whole of 2020.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/62811/038b.jpg&quot;);"><a href="https://says.com/my/news/cat-survives-fall-from-6-storeys-high-car-window-smash-in-thailand" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/cat-survives-fall-from-6-storeys-high-car-window-smash-in-thailand" class="ga-curator-related">Cat Survives Smashing Into Car Window After 6-Storey Fall Without Breaking Any Bones</a></h6>
<p>The cat&#8217;s name is Shifu, like Master Shifu from &#8216;Kung Fu Panda&#8217;.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-502571" name="segment-502571" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Read more cute <a href="https://says.com/my/cat" target="_blank" rel="noopener">#cat</a> stories on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/67697/d5f3.jpg&quot;);"><a href="https://says.com/my/fun/cat-grabs-food-from-under-door" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-grabs-food-from-under-door" class="ga-curator-related">Funny Cat Grabs Food From Under Door Like He&#8217;s Been &#8220;Locked Up In Prison&#8221; For Years</a></h6>
<p>Just black cat things.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66770/01c1.jpg&quot;);"><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day</a></h6>
<p>Cutest thing you&#8217;ll see all year.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66654/cdf1.jpg&quot;);"><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">[VIDEO] M&#8217;sian Shares What Her Dad Is Up To After Retirement &#038; It&#8217;s Super Relatable</a></h6>
<p>It&#8217;s always the Asian parent who didn&#8217;t want a pet.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Oyen Gets Its Head Stuck In A Wall & Is Saved By The Civil Defence Force

<article>
<div class="each-segment">
    <a id="segment-502106" name="segment-502106" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>
<p>
<p><p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>,&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502107" name="segment-502107" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Cats do the darnedest things sometimes and this little black fellow is no exception</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>A <a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830">TikTok</a> posted by Heaven Jirak has been going viral after she showed how her cat gets food from her.</p>
<p>In the video, Heaven is seen putting a plate of cat food on the floor in front of a door. </p>
<p>Before she can even let go of the plate, a black paw slides under the door and quickly grabs the plate from the other side in less than a second.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218967/8306.gif" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218967" alt="" src="https://images.says.com/uploads/story_source/source_image/1218967/8306.gif"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">@heaven.like.the.place (TikTok)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502111" name="segment-502111" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The video has the Internet in stitches, with many likening the cat&#8217;s antics to that of a prisoner locked away in confinement</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218977/f7e4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218977" alt="" src="https://images.says.com/uploads/story_source/source_image/1218977/f7e4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218978/0390.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218978" alt="" src="https://images.says.com/uploads/story_source/source_image/1218978/0390.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218979/a697.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218979" alt="" src="https://images.says.com/uploads/story_source/source_image/1218979/a697.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218980/80de.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218980" alt="" src="https://images.says.com/uploads/story_source/source_image/1218980/80de.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218981/3ad4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218981" alt="" src="https://images.says.com/uploads/story_source/source_image/1218981/3ad4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218982/6653.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218982" alt="" src="https://images.says.com/uploads/story_source/source_image/1218982/6653.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218983/e00b.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218983" alt="" src="https://images.says.com/uploads/story_source/source_image/1218983/e00b.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>After one person pointed out that she could imagine the &#8220;jailbird&#8221; just waiting patiently on the other end for his food, Heaven shared a video of the cat&#8217;s point-of-view.</p>
</div>
</div>
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7334440173205310763" data-video-id="7334440173205310763" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>Replying to @Side of Sunny impatiently waiting</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7334440299365780267?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="text">
<div class="">
<p>He indeed waits patiently and immediately snatches the plate from her as soon he hears it coming.</p>
<p>Watch his POV below:﻿</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502120" name="segment-502120" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Heaven revealed that her cat&#8217;s name is Bill and he is one of her four cats at home</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>Speaking to SAYS, she said she got Bill when he was just nine weeks old as a wedding gift from her husband. Bill will turn one next month. </p>
<p>She explained that Bill is &#8220;fed like a solitary inmate&#8221; because he won&#8217;t let her other cats eat, and he sometimes smacks the bowl out of her hands. </p>
<p>So far, this method seems to be effective, as she mentioned that she has tried slow feeders in the past, but Bill would just bite the plastic out of anger. &#8220;He&#8217;s just a little piggy and steals food,&#8221; she added.</p>
<p>Here&#8217;s a close-up of Bill:</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219004/30b9.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219004" alt="" src="https://images.says.com/uploads/story_source/source_image/1219004/30b9.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7334085421506366763" rel="noopener">@heaven.like.the.place (TikTok)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>
</p>
</p>
</p>
</p>
</p>
<p>Bill also often behaves like the &#8216;ultimate youngest child&#8217; by instigating conflicts with the other cats, then crying out for help when faced with consequences, she said, providing a video as proof.</p>
<p>You can watch it below:</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7334776816500002090" data-video-id="7334776816500002090" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>bill is the ultimate youngest child, starts shit then screams for help when there are consequences.</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7334777002487974699?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502112" name="segment-502112" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>As naughty as Bill is though, he does have some tricks up his paw</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7308444701156232491" data-video-id="7308444701156232491" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>we call this one kill bill <a title="catsoftiktok" target="_blank" href="https://www.tiktok.com/tag/catsoftiktok?refer=embed" rel="noopener">#catsoftiktok</a> <a title="cat" target="_blank" href="https://www.tiktok.com/tag/cat?refer=embed" rel="noopener">#cat</a> <a title="britishshorthair" target="_blank" href="https://www.tiktok.com/tag/britishshorthair?refer=embed" rel="noopener">#britishshorthair</a> </p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7308444779703110446?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="text">
<div class="">
<p>When she pretends to hold Bill at &#8216;gunpoint&#8217; with her fingers and &#8216;shoots&#8217;, Bill can flop over as if he has just been shot.</p>
<p>She refers to the trick shot as <i>Kill Bill</i>.&nbsp;</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502113" name="segment-502113" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Watch the video of how she feeds him below:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" data-video-id="7333745089052822830" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>this is the easiest way to feed our fouth and craziest cat</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7333745214325312302?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502121" name="segment-502121" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Cat antics will never stop being funny:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66770/01c1.jpg&quot;);"><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day</a></h6>
<p>Cutest thing you&#8217;ll see all year.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/63726/1b55.jpg&quot;);"><a href="https://says.com/my/fun/cat-goes-bald-because-its-friend-keeps-licking-its-head" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-goes-bald-because-its-friend-keeps-licking-its-head" class="ga-curator-related">Cat Goes Bald Because Its Friend Keeps Licking Its Head So Owner Comes Up With Solution</a></h6>
<p>Appropriate solution.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/55920/319c.jpg&quot;);"><a href="https://says.com/my/fun/hilariously-cute-curious-cat-staring-into-its-owner-s-new-cctv" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/hilariously-cute-curious-cat-staring-into-its-owner-s-new-cctv" class="ga-curator-related">Hilariously Cute, &#8216;Kepoh&#8217; Cat Goes Viral For Continuously Staring Into Owner&#8217;s New CCTV</a></h6>
<p>The cutest staredown.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/51246/3201.jpg&quot;);"><a href="https://says.com/my/fun/cat-goes-viral-for-looking-like-dad-who-fall-asleep-on-the-couch" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-goes-viral-for-looking-like-dad-who-fall-asleep-on-the-couch" class="ga-curator-related">Cat Goes Viral For Looking Like A Dad Who Fell Asleep On The Couch</a></h6>
<p>Floof.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/52461/5cc7.jpg&quot;);"><a href="https://says.com/my/fun/malaysian-viral-crochet-cat-hats" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/malaysian-viral-crochet-cat-hats" class="ga-curator-related">Malaysian Crochets And Sells Cat Hats &#038; These Review Photos Are Giving Me Life</a></h6>
<p>The Internet loves them, Bob tolerates them.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Funny Cat Grabs Food From Under Door Like He's Been "Locked Up In Prison" For Years

Funny Cat Grabs Food From Under Door Like He’s Been “Locked Up In Prison” For Years

<article>
<div class="each-segment">
    <a id="segment-501632" name="segment-501632" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>
<p>
<p><p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>, <a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and <a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-501633" name="segment-501633" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>It was a cold morning when I discovered my hamster frozen with its teeth clenched around its cage</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>The unfortunate day I discovered Hooey died was a sad one, the 4th of July. We held a burial service for him, and my sister made a &#8216;gravestone&#8217; for him. </p>
<p>With a marker pen, she wrote his name and the years he was alive on half a transparent CD cover and stuck it into the ground where we buried him.</p>
<p><b>But&#8230; was Hooey truly dead? Or could he have just been &#8216;hibernating&#8217;?&nbsp;</b></p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218158/a832.jpg" target="" class="imgwrap colorbox-image cboxElement" title="Image for illustration purposes only." rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218158" alt="Image for illustration purposes only." src="https://images.says.com/uploads/story_source/source_image/1218158/a832.jpg"> </a>
                </div>
<p class="img-caption">Image for illustration purposes only.</p>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.theprogress.com/community/chilliwack-veterinarian-stubbles-across-childs-hamster-memorial-on-trail-1907086" rel="noopener">Dr Leslie Ann Ross/The Chilliwack Progress</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-501637" name="segment-501637" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Decades later, I&#8217;ve discovered that certain hamster types, such as Siberian and dwarf hamsters, actually &#8216;hibernate&#8217; in the wild to survive colder climates</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><b>Whether your pet hamster actually does this or not depends on the temperature you maintain in your home. </b></p>
<p>Veterinary nurse Leah Feusse told <a target="_blank" rel="nofollow noopener" href="https://www.thedodo.com/dodowell/do-hamsters-hibernate">The Dodo</a>, &#8220;Pet hamsters will begin &#8216;hibernating&#8217; if the temperature of their habitat drops below 65ºF (18ºC) for more than 24 hours.&#8221;</p>
<p>For the most part, &#8220;<b>pet hamsters don&#8217;t usually hibernate</b> when they&#8217;re used to living in comfortable temperatures that don&#8217;t change much,&#8221; according to The Dodo.</p>
<p>In other words,<b> it&#8217;s </b><a target="_blank" rel="nofollow noopener" href="https://woodgreen.org.uk/pet-advice/hamster/do-hamsters-hibernate-and-what-is-torpor/"><b>dangerous for your pet</b></a><b> hamster to &#8216;hibernate&#8217;</b>, or to use the more correct term — torpor. </p>
<p>Torpor is an involuntary state of reduced mental or motor activity. It&#8217;s&nbsp;a survival tactic automatically triggered when an animal gets too cold or has limited access to food and water.<b></b></p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218137/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218137" alt="" src="https://images.says.com/uploads/story_source/source_image/1218137/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://unsplash.com/photos/a-hamster-in-a-house-with-a-pine-cone-r149yvhlJ4Q" rel="noopener">Sunira Moses/Unsplash</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-501646" name="segment-501646" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Here&#8217;s how to tell if your hamster is in torpor:</p>
<p>I. Observe it closely for signs of life — these may include minor twitching, a gentle jerk or tremble, or slowed-down breathing</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>Despite appearing motionless and &#8216;dead&#8217;, hamsters in a torpid state usually exhibit signs of life. You can lightly stroke their paw or whiskers, which might elicit a response. Watch their chest or abdomen closely for signs of breathing. </p>
<p>&#8220;When &#8216;hibernating&#8217;, <b>a hamster can slow their breathing down to only one breath every two minutes, so be patient.</b> You can also feel their ribcage, just above their elbows, for a heartbeat,&#8221; Feusse&nbsp;explains.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218138/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218138" alt="" src="https://images.says.com/uploads/story_source/source_image/1218138/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://unsplash.com/photos/selective-focus-photography-of-mouse-9_V3wHZaS68" rel="noopener">Kong Jun/Unsplash</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-501653" name="segment-501653" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>2. Check its body temperature</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>Despite a hamster&#8217;s body temperature dropping during torpor and appearing mostly cold and lifeless, there could still be a faint indication of warmth.</p>
<p>Touch your hamster gently to check if it is a tiny bit warm. Dead hamsters will be stone cold. (<i>Hooey was found stone cold, so I guess it was his time to go after all. RIP, Hooey. T.T &lt;3</i>).<b></b></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-501655" name="segment-501655" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>3. Check if your pet hamster&#8217;s body is limp or stiff</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><b><u>Do this as a last resort</u> </b>if you really can&#8217;t tell if your hamster is dead or in a torpid state, as <b><u>moving your hamster could cause it stress or harm its health</u></b>.</p>
<p>If you pick it up in a torpid state, its body will be limp. On the other hand, a deceased hamster will be completely stiff as it undergoes rigor mortis, a process where the muscles and joints stiffen after a couple of hours of death.</p>
<p><b>Make sure that you handle this step with care and sensitivity</b>, as the health of your hamster should be your number one priority.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218139/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218139" alt="" src="https://images.says.com/uploads/story_source/source_image/1218139/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://hamsterscape.nl/en/2020/08/19/hibernation-or-torpor/" rel="noopener">Hamsterscape</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-501661" name="segment-501661" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>If you have determined that your pet hamster is in torpor, this suggests that you need to adjust its habitat</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>In the wild, when a hamster enters a state of torpor, it will typically last two to three days. However, in more rigid conditions, it could last a week. </p>
<p><b>In a domestic situation, your pet hamster <u>should only be in torpor for 24 hours.</u></b> <b>Anything longer may lead to your pet&#8217;s starvation or dehydration. </b>That&#8217;s why it&#8217;s important to closely monitor your hamster&#8217;s needs.</p>
<p>One way to safely revive your pet is to increase the temperature of its environment with body warmth. According to <a target="_blank" rel="nofollow noopener" href="https://petsvills.com/do-hamsters-hibernate/">Pets Vills</a>, you can do this by gently picking up your hamster and holding it close to your body for warmth for 30 minutes. </p>
<p>Alternatively, you can use a hot water bottle filled with hot water (not boiling). Wrap it in a towel or cloth and place it near your pet to transfer heat.&nbsp;</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-501662" name="segment-501662" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Just remember that when you&#8217;re warming your pet, do it gradually and gently</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>You&#8217;ll want to ensure that its temperature slowly adjusts. <b>Any sudden changes in temperature may cause stress or be harmful to your pet hamster.</p>
<p></b>Also, be mindful that if your hamster has entered a state of torpor, it&#8217;s an indication that its environment needs to be adjusted.<br /><b></b></p>
</div>
</div>
<div class="text">
<div class="">
<p><i><b>Sources: </b></i><a target="_blank" rel="nofollow noopener" href="https://www.thedodo.com/dodowell/do-hamsters-hibernate"><i><b></b>The Dodo</i></a><i>, </i><a target="_blank" rel="nofollow noopener" href="https://petsvills.com/do-hamsters-hibernate/"><i>Pets Vills<b></b></i></a><i></i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-501700" name="segment-501700" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Read more fun facts on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://storage.googleapis.com/says_image_uploader/uploads/temp/Your_paragraph_text__93_.png&quot;);"><a href="https://says.com/my/fun/what-are-dragon-chickens" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/what-are-dragon-chickens" class="ga-curator-related">Ever Seen A Dragon Chicken Before? They&#8217;re Known For Their Large Feet &#038; Cost Up To RM1.9K</a></h6>
<p>Apparently, they&#8217;re delicious!</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66343/f07a.jpg&quot;);"><a href="https://says.com/my/fun/people-are-now-finding-out-how-bird-feathers-grow" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/people-are-now-finding-out-how-bird-feathers-grow" class="ga-curator-related">People Are Finding Out How Bird Feathers Grow &#038; This Is Not Something I Needed To Know</a></h6>
<p>&#8220;Feather unboxing.&#8221;</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/63115/0cb4.jpg&quot;);"><a href="https://says.com/my/lifestyle/til-millipedes-are-poisonous" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/til-millipedes-are-poisonous" class="ga-curator-related">Did You Know: Millipedes Can Burn You</a></h6>
<p>Thinking of all the times we played with millipedes when we were children.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66847/9678.jpg&quot;);"><a href="https://says.com/my/lifestyle/flamingos-aren-t-born-pink" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/flamingos-aren-t-born-pink" class="ga-curator-related">Did You Know: Flamingos Aren&#8217;t Born With Their Iconic Pink Colour</a></h6>
<p>Yep, they are born with some pretty standard grey feathers. So, how on earth do they end up looking like a walking sunset?</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/54019/0675.jpg&quot;);"><a href="https://says.com/my/fun/people-are-discovering-where-birds-ears-are-located" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/people-are-discovering-where-birds-ears-are-located" class="ga-curator-related">People Are Discovering Where Birds&#8217; Ears Are Located And Now I Can&#8217;t Unsee Them</a></h6>
<p>Wash my eyes with soap pls.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Did You Know: Hamsters That Appear To Be Dead May Sometimes Just Be 'Hibernating'

Did You Know: Hamsters That Appear To Be Dead May Sometimes Just Be ‘Hibernating’

<article>
<div class="each-segment">
    <a id="segment-501458" name="segment-501458" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>
<p>
<p><p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>,&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-501459" name="segment-501459" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>&#8216;Alpaca&#8217; your bags and camera, and head to this new café in Johor!</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217705/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217705" alt="" src="https://images.says.com/uploads/story_source/source_image/1217705/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C3HwaHhvHYE/" rel="noopener">@ascloudsjb (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217706/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217706" alt="" src="https://images.says.com/uploads/story_source/source_image/1217706/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C2L-S9pvdRW/" rel="noopener">@ascloudsjb (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>Located in Skudai, <b>As Clouds </b>is<b>&nbsp;</b>a café where you&#8217;re greeted by not only the aroma of freshly brewed coffee, but also by the adorable presence of alpacas.</p>
<p>You&#8217;re welcome to enjoy food or drinks from the menu while petting or simply enjoying the company of these fluffy animals, with no entrance fee or minimum spend required as long as you&#8217;re dining in or ordering something.</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-501468" name="segment-501468" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>As you dine, you&#8217;ll find the gentle, charming creatures freely roaming throughout the entire café</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217729/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217729" alt="" src="https://images.says.com/uploads/story_source/source_image/1217729/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C3PwCwxLc6S/" rel="noopener">@sivavijayy (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>According to <a target="_blank" rel="nofollow noopener" href="https://confirmgood.com/post/as-clouds-cafe-jb/">Confirm Good</a>, the alpacas &#8220;alternate shifts&#8221; and you can ask for a free carrot to offer them as a snack.</p>
<p>Numerous reviews highlight that the café pleasantly lacks the typical &#8220;animal smell&#8221; associated with such venues, making dining there a more enjoyable experience.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217747/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217747" alt="" src="https://images.says.com/uploads/story_source/source_image/1217747/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C3Ewx27vcNu/" rel="noopener">@channcindy (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217748/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217748" alt="" src="https://images.says.com/uploads/story_source/source_image/1217748/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C3Ewx27vcNu/" rel="noopener">@channcindy (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-501476" name="segment-501476" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The pork-free café offers Western fusion dishes, such as burgers, fish and chips, pizza, and salads</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>There&#8217;s also Japanese Katsu Curry Omu Salmon Omu Rice, and other rice bowl or pasta options. For dessert, there&#8217;s Big Cat Pudding and cakes, among others.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217750/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217750" alt="" src="https://images.says.com/uploads/story_source/source_image/1217750/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://confirmgood.com/post/as-clouds-cafe-jb/" rel="noopener">灰猫吐司探店中/RED/Confirm Good</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217751/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217751" alt="" src="https://images.says.com/uploads/story_source/source_image/1217751/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C3PwCwxLc6S/" rel="noopener">@sivavijayy (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217752/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217752" alt="" src="https://images.says.com/uploads/story_source/source_image/1217752/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://confirmgood.com/post/as-clouds-cafe-jb/" rel="noopener">灰猫吐司探店中/RED/Confirm Good</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>The café operates on a walk-in basis only, meaning they don&#8217;t take reservations. So, if you plan to visit, be prepared for a potential wait in line.</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-501463" name="segment-501463" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Here&#8217;s where As Clouds is located:</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><b><u>Address</u></b><br />32, Jalan Nakhoda 2, Taman Ungku Tun Aminah, <br />81300 Skudai, Johor</p>
<p><b><u>Opening hours<br /></u></b>11am &#8211; 9.30pm (Monday to Friday)<br />11am &#8211; 1am (Saturday)<br />11am &#8211; 10pm (Sunday)</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1217731/null" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1217731" alt="" src="https://images.says.com/uploads/story_source/source_image/1217731/null"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.instagram.com/p/C3Oyu9wPz_z/" rel="noopener">@ascloudsjb (Instagram)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-501466" name="segment-501466" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>In Johor, you&#8217;ll find other animal cafés featuring adorable breeds like corgis and shiba inus:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/55676/047f.png&quot;);"><a href="https://says.com/my/lifestyle/come-and-pet-floofs-at-malaysia-first-shiba-inu-dog-cafe-in-johor" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/come-and-pet-floofs-at-malaysia-first-shiba-inu-dog-cafe-in-johor" class="ga-curator-related">Come And Pet Some Floofs At Malaysia&#8217;s First Shiba Inu Dog Cafe In Johor</a></h6>
<p>Is this heaven?</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/57096/32c3.png&quot;);"><a href="https://says.com/my/makan/corgis-talk-cafe-johor" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/makan/corgis-talk-cafe-johor" class="ga-curator-related">Snuggle With Adorable Corgis At This Corgi-Themed Café In Johor</a></h6>
<p>OMG. So. Cute.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-501478" name="segment-501478" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>There&#8217;s a wedding venue that lets you hire an unlikely groomsman if you need one:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/63477/7c47.jpg&quot;);"><a href="https://says.com/my/fun/wedding-venue-lets-you-hire-a-llama-dressed-in-a-tuxedo-if-you-need-a-groomsman" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/wedding-venue-lets-you-hire-a-llama-dressed-in-a-tuxedo-if-you-need-a-groomsman" class="ga-curator-related">Wedding Venue Lets You Hire A Llama Dressed In A Tuxedo If You Need A Groomsman</a></h6>
<p>No groomsman? No prob-llama.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


There’s A New Café In Johor With 2 Adorable, Floofy Alpacas To Welcome You

Ever Seen A Dragon Chicken Before? They’re Known For Their Large Feet & Cost Up To RM1.9K

<article>
<div class="each-segment">
    <a id="segment-495218" name="segment-495218" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>, <a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and <a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-495219" name="segment-495219" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The Sarawak Fire and Rescue Department (Bomba) held an emotional ceremony yesterday, 4 January, to bid farewell to one of its K9 comrades, Cliff, who had served in the unit for six years</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204912/718c.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204912" alt="" src="https://images.says.com/uploads/story_source/source_image/1204912/718c.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/BombaSarawak999/posts/928527338840652" rel="noopener">Jabatan Bomba dan Penyelamat Malaysia Negeri Sarawak (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p><p>The department shared on <a target="_blank" rel="nofollow noopener" href="https://www.facebook.com/BombaSarawak999/posts/928527338840652">Facebook</a> that Cliff died last month due to complications caused by a bladder tumour.</p>
<p>His handler, 47-year-old Steven Ambu, told <a target="_blank" rel="nofollow noopener" href="https://www.theborneopost.com/2024/01/04/bomba-holds-moving-final-farewell-in-serian-for-four-legged-hero-cliff-video/">The Borneo Post</a> that <b>the dog showed no signs of illness and expressed regret that Cliff died on Christmas Day.</b></p>
<p>Sarawak Bomba wrote that Steven could not hold back tears as his canine companion was finally laid to rest at the Serian fire station grounds on Thursday.</p>
</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1205051/a287.jpeg" target="" class="imgwrap colorbox-image cboxElement" title="Cliff." rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1205051" alt="Cliff." src="https://images.says.com/uploads/story_source/source_image/1205051/a287.jpeg"> </a>
                </div>
<p class="img-caption">Cliff.</p>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/BombaSarawak999/posts/923242329369153" rel="noopener">Jabatan Bomba dan Penyelamat Malaysia Negeri Sarawak (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-495227" name="segment-495227" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Steven said Cliff was his first canine trainee when he began work at the department in 2018</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>&#8220;We started together in the same year; I reported in early, while Cliff joined in December 2018,&#8221; he said.</p>
<p>Describing his canine companion, <b>the handler was proud to say Cliff was always an obedient dog, and demonstrated remarkable characteristics during rescue operations.</b></p>
<p>Steven added that Cliff was an English Springer Spaniel born in January 2016, and was trained in cadaver detection.</p>
</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204923/f1aa.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204923" alt="" src="https://images.says.com/uploads/story_source/source_image/1204923/f1aa.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.newsarawaktribune.com.my/bomba-k9-handler-bids-tearful-adieu-to-loyal-canine-companion/" rel="noopener">New Sarawak Tribune</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-495291" name="segment-495291" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Sarawak Bomba director Datu Khirudin Drahman also paid a touching tribute to the fallen canine, calling Cliff&#8217;s death a tragedy for the team</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>&#8220;The loss of Cliff is not just a tragedy but a personal loss for his handler, Steven, who has been inseparable from him since Cliff was a small puppy.</p>
<p><b>&#8220;Losing Cliff feels like losing a cherished family member, and today, we witness the genuine sorrow on Steven&#8217;s face,&#8221; </b>he told the Sarawak daily.</p>
<p>&#8220;From bathing to taking medication, every aspect of life was shared. In losing Cliff, we recognise the depth of the bond that echoes the sentiment that a dog is truly man&#8217;s best friend,&#8221; he added.</p>
</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1205053/ed22.jpg" target="" class="imgwrap colorbox-image cboxElement" title="Steven (second from left), Khirudin, (third from left) and other firefighters sharing a moment of silence to honour Cliff at his funeral yesterday, 4 January." rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1205053" alt="Steven (second from left), Khirudin, (third from left) and other firefighters sharing a moment of silence to honour Cliff at his funeral yesterday, 4 January." src="https://images.says.com/uploads/story_source/source_image/1205053/ed22.jpg"> </a>
                </div>
<p class="img-caption">Steven (second from left), Khirudin, (third from left) and other firefighters sharing a moment of silence to honour Cliff at his funeral yesterday, 4 January.</p>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.newsarawaktribune.com.my/bomba-k9-handler-bids-tearful-adieu-to-loyal-canine-companion/" rel="noopener">New Sarawak Tribune</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-495298" name="segment-495298" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Khirudin added that Cliff played a crucial role in many time-sensitive rescue missions, where they had to locate victims quickly to prevent fatal delays</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>&#8220;His remarkable abilities streamlined the process of finding and rescuing victims, ensuring immediate emergency assistance and hospital care,&#8221; he said.</p>
<p>The dog had participated in more than 10 firefighting operations, and had also successfully located lost victims in risky river areas in Ulu Skrang and Long Miri.</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-495220" name="segment-495220" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Watch the team give Cliff a proper send off yesterday:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper"><iframe loading="lazy" src="https://www.facebook.com/plugins/video.php?height=314&#038;href=https%3A%2F%2Fwww.facebook.com%2FBombaSarawak999%2Fvideos%2F1773572036444815%2F&#038;show_text=false&#038;width=560&#038;t=0" width="560" height="314" style="border:none;overflow:hidden" scrolling="no" frameborder="0" allowfullscreen="true" allow="autoplay; clipboard-write; encrypted-media; picture-in-picture; web-share" allowFullScreen="true"></iframe></div>
</div>
<div class="each-segment">
    <a id="segment-495228" name="segment-495228" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>K9 unit dogs are not only cute, but are also held in high regard for helping to solve crimes:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66334/ae45.jpg&quot;);"><a href="https://says.com/my/fun/video-netizens-applaud-pdrm-for-fun-k9-unit-demonstration-at-shah-alam-high-school" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/video-netizens-applaud-pdrm-for-fun-k9-unit-demonstration-at-shah-alam-high-school" class="ga-curator-related">[VIDEO] Netizens Applaud PDRM For Fun K9 Unit Demonstration At Shah Alam High School</a></h6>
<p>&#8220;Well done to the school! Hope more schools will follow,&#8221; said an Instagram user.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/65069/871b.jpg&quot;);"><a href="https://says.com/my/news/budget2024-bomba-s-k9-unit-to-get-rm5-million-in-honour-of-blake" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/budget2024-bomba-s-k9-unit-to-get-rm5-million-in-honour-of-blake" class="ga-curator-related">&#8220;Remember Blake&#8221; — Bomba&#8217;s K9 Unit Gets RM5 Million Allocation In Honour Of Hero Dog</a></h6>
<p>The brave dog was put to sleep last month after his battle with stage four lymphoma.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/59968/7852.jpg&quot;);"><a href="https://says.com/my/news/batang-kali-sniffer-dogs-awarded-with-medals" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/batang-kali-sniffer-dogs-awarded-with-medals" class="ga-curator-related">&#8220;The Fantastic 6&#8221;: Batang Kali K9 Sniffer Dogs Awarded With &#8216;Golden Performance&#8217; Medals</a></h6>
<p>Missing from the award ceremony were Frankie and Denti, who were on standby for a mission.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/49379/f150.png&quot;);"><a href="https://says.com/my/news/pdrm-dog-drug-bust" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/pdrm-dog-drug-bust" class="ga-curator-related">Waiko The Labrador&#8217;s Sniffing Leads To Arrest Of 16 Drug Traffickers</a></h6>
<p>The six-year-old Labrador has been on the prowl, sniffing out drugs and catching traffickers in Kerian district, Perak since January.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


"We Started Together" — K9 Handler Can't Hold Back Tears At Four-Legged Friend's Funeral

“We Started Together” — K9 Handler Can’t Hold Back Tears At Four-Legged Friend’s Funeral

<article>
<div class="each-segment">
    <a id="segment-494930" name="segment-494930" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://instagram.com/saysdotcom">Instagram</a>, <a target="_blank" rel="nofollow noopener" href="https://tiktok.com/@saysdotcom">TikTok</a>, and <a target="_blank" rel="nofollow noopener" href="https://whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-494957" name="segment-494957" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>A chonky cat in China is stealing hearts for visiting a noodle shop to get a strand of noodles to eat with his kibble every day.</p>
<p>And he is adorably named Popsicle.</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>His equally adorable routine is posted on Douyin daily by his owner under the handle <a target="_blank" rel="nofollow noopener" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB">@槟榔石榴爱冰棍</a>.</p>
<p>The account is named after the owner&#8217;s three cats: Betel Nut (槟榔), Pomegranate (石榴), and Popsicle (冰棍), but <b>it is Popsicle that always steals the limelight.</b></p>
</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204463/2e4c.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204463" alt="" src="https://images.says.com/uploads/story_source/source_image/1204463/2e4c.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB" rel="noopener">@槟榔石榴爱冰棍 (Douyin)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-495003" name="segment-495003" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The endearing videos always show Popsicle running excitedly from his home across the street to get noodles for &#8216;takeout&#8217;</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>The owner shares that the shop lady always reserves a strand for him for breakfast, and he sometimes even returns for another strand at lunch.</p>
<p>One of their most viral videos shows how Popsicle masterfully takes the noodle strand from the shop owner with his mouth, and carefully holds it while<b>&nbsp;happily trotting back home to put it into his bowl.</b></p>
<p><b></b>Popsicle&#8217;s owner said he never takes a bite on the way home and enjoys eating the noodle with the other food in his bowl.</p>
<p><b></b></p>
</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204439/630c.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204439" alt="" src="https://images.says.com/uploads/story_source/source_image/1204439/630c.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB" rel="noopener">@槟榔石榴爱冰棍 (Douyin)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204464/d46f.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204464" alt="" src="https://images.says.com/uploads/story_source/source_image/1204464/d46f.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB" rel="noopener">@槟榔石榴爱冰棍 (Douyin)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-495004" name="segment-495004" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Popsicle&#8217;s routine has gained over hundreds of thousands of views, with tonnes of netizens admiring the little cat&#8217;s independent runs for noodles</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>&#8220;I don&#8217;t understand why Popsicle must go home and put the noodle in his bowl before eating it,&#8221; commented an amused Douyin user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204442/b1fe.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204442" alt="" src="https://images.says.com/uploads/story_source/source_image/1204442/b1fe.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB?relation=0&#038;vid=7310951397158079779" rel="noopener">Douyin</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>&#8220;His tummy is almost touching the floor,&#8221; laughed another.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204444/839d.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204444" alt="" src="https://images.says.com/uploads/story_source/source_image/1204444/839d.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB?relation=0&#038;vid=7310951397158079779" rel="noopener">Douyin</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>While another said, &#8220;He must have eaten one too many noodles to get that chonky.&#8221;</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204446/c9d4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204446" alt="" src="https://images.says.com/uploads/story_source/source_image/1204446/c9d4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB?relation=0&#038;vid=7310951397158079779" rel="noopener">Douyin</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-494966" name="segment-494966" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Watch one of Popsicle&#8217;s noodle run videos here:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<div style="position:relative; width:100%; height:0px; padding-bottom:177.778%"><iframe loading="lazy" allow="fullscreen" allowfullscreen height="100%" src="https://streamable.com/e/mvw5jd?nocontrols=1" width="100%" style="border:none; width:100%; height:100%; position:absolute; left:0px; top:0px; overflow:hidden;"></iframe></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-494967" name="segment-494967" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Read more cute <a href="https://says.com/my/stories/tagged/cats" target="_blank" rel="noopener">#cat</a> stories on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66654/cdf1.jpg&quot;);"><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">[VIDEO] M&#8217;sian Shares What Her Dad Is Up To After Retirement &#038; It&#8217;s Super Relatable</a></h6>
<p>It&#8217;s always the Asian parent who didn&#8217;t want a pet.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/65854/dd86.jpg&quot;);"><a href="https://says.com/my/lifestyle/cat-beach-in-penang-where-300-cats-roam-freely-can-be-adopted" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/cat-beach-in-penang-where-300-cats-roam-freely-can-be-adopted" class="ga-curator-related">There&#8217;s A Cat Beach In Penang Where 300 Adorable Kitties Roam Freely &#038; Can Be Adopted</a></h6>
<p>A cat lover&#8217;s paradise. :&#8217;)</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/64652/74d9.png&quot;);"><a href="https://says.com/my/fun/cat-blocks-exit-gate-lrt-station" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-blocks-exit-gate-lrt-station" class="ga-curator-related">&#8220;Chief Meow&#8221; — Cat Leisurely Sits On &#038; Blocks Exit Gate Scanner At LRT Station</a></h6>
<p>&#8220;The cat&#8217;s making sure the card gets tapped,&#8221; wrote one commenter.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/62302/f64e.jpg&quot;);"><a href="https://says.com/my/fun/woman-dresses-her-61-cats-in-matching-outfits-for-hari-raya" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/woman-dresses-her-61-cats-in-matching-outfits-for-hari-raya" class="ga-curator-related">Penang Woman Dresses Her 61 Cats In Matching Outfits For Hari Raya</a></h6>
<p>Matchy-matchy.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day