These Cat & Dog Cafés In Johor Bahru Have The Cutest Floofs To Sayang

<article>
<div class="each-segment">
    <a id="segment-502501" name="segment-502501" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on </i><i><a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a></i><i>, </i><i><a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a></i><i>, and </i><i><a target="_blank" rel="nofollow noopener" href="https://whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a></i><i>&nbsp;for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502568" name="segment-502568" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>A ginger cat found itself in a pickle after it stuck its head into a hole in an apartment building&#8217;s wall</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219875/daec.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219875" alt="" src="https://images.says.com/uploads/story_source/source_image/1219875/daec.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219876/8cfa.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219876" alt="" src="https://images.says.com/uploads/story_source/source_image/1219876/8cfa.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p><p>It was rescued by officers from the Civil Defence Force (APM) after they received an emergency call from a homeowner in Kota Kinabalu, Sabah.</p>
<p>The person reported that a cat was trapped in the wall of their home.</p>
<p>According to the APM&#8217;s <a href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l">Facebook post</a>, here is the sight that met their eyes:</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502569" name="segment-502569" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>To rescue the silly cat, the officers wore protective suits and used a power saw and other rescue tools to cut through the wall</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219877/9d21.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219877" alt="" src="https://images.says.com/uploads/story_source/source_image/1219877/9d21.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502582" name="segment-502582" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The cat seemed not at all embarrassed when it was successfully freed</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220010/dc06.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220010" alt="" src="https://images.says.com/uploads/story_source/source_image/1220010/dc06.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">APM Kota Kinabalu (Facebook)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502583" name="segment-502583" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Amused netizens thanked the APM officers for saving the curious feline, and also laughed at the orange cat&#8217;s &#8220;typical behaviour&#8221;</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>&#8220;Oyens are really so naughty, hahaha. The oyen must&#8217;ve said, &#8216;Thank you, APM brothers for saving me&#8217;,&#8221; said a Facebook user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220012/12f3.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220012" alt="" src="https://images.says.com/uploads/story_source/source_image/1220012/12f3.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.facebook.com/APMDaerahKotaKinabalu/posts/pfbid0qfjZU9JKXCqFb654UYBQaHGqw7NWJDQLoQs7V16BTSmqMoQJN1Vd4uSkzJ4ot114l" rel="noopener">Facebook</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>&#8220;Oyens must always find themselves in some kind of trouble, right? I wonder what was it doing to get stuck in there,&#8221; said a Twitter user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220014/c515.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220014" alt="" src="https://images.says.com/uploads/story_source/source_image/1220014/c515.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>Another laughed at the cat&#8217;s expression of defeat while it was stuck in the hole.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220016/2dc1.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220016" alt="" src="https://images.says.com/uploads/story_source/source_image/1220016/2dc1.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>While another said, &#8220;It looks so pitiful, but this is too funny.&#8221;</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1220018/03d0.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1220018" alt="" src="https://images.says.com/uploads/story_source/source_image/1220018/03d0.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://twitter.com/anthraxxx781/status/1759164099228053546" rel="noopener">Twitter</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502502" name="segment-502502" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The incident was also turned into a funny TikTok by APM:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@apmkotakinabalu/video/7336505779140267282" data-video-id="7336505779140267282" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@apmkotakinabalu" href="https://www.tiktok.com/@apmkotakinabalu?refer=embed" rel="noopener">@apmkotakinabalu</a> </p>
<p>Oyen yang terpaling penat, terpaling buat hal. Tapi syukur ada abam APM selamatkan oyen <a title="oyenbuathallagi" target="_blank" href="https://www.tiktok.com/tag/oyenbuathallagi?refer=embed" rel="noopener">#oyenbuathallagi</a> <a title="bukanoyenjebuatperangai" target="_blank" href="https://www.tiktok.com/tag/bukanoyenjebuatperangai?refer=embed" rel="noopener">#bukanoyenjebuatperangai</a> <a title="fyp" target="_blank" href="https://www.tiktok.com/tag/fyp?refer=embed" rel="noopener">#fyp</a> <a title="apmsabah" target="_blank" href="https://www.tiktok.com/tag/apmsabah?refer=embed" rel="noopener">#APMSABAH</a> <a title="apmkotakinabalu" target="_blank" href="https://www.tiktok.com/tag/apmkotakinabalu?refer=embed" rel="noopener">#APMKotaKinabalu</a> <a title="apmsanasini" target="_blank" href="https://www.tiktok.com/tag/apmsanasini?refer=embed" rel="noopener">#apmsanasini</a> <a title="fypage" target="_blank" href="https://www.tiktok.com/tag/fypage?refer=embed" rel="noopener">#fypage</a> <a title="angkatanpertahananawammalaysia" target="_blank" href="https://www.tiktok.com/tag/angkatanpertahananawammalaysia?refer=embed" rel="noopener">#angkatanpertahananawammalaysia</a> <a title="abamapm" target="_blank" href="https://www.tiktok.com/tag/abamapm?refer=embed" rel="noopener">#abamAPM</a> <a title="segakberseragam" target="_blank" href="https://www.tiktok.com/tag/segakberseragam?refer=embed" rel="noopener">#segakberseragam</a> <a title="pakaianberuniform" target="_blank" href="https://www.tiktok.com/tag/pakaianberuniform?refer=embed" rel="noopener">#pakaianberuniform</a> <a title="viral" target="_blank" href="https://www.tiktok.com/tag/viral?refer=embed" rel="noopener">#viral</a> <a title="videooftheday" target="_blank" href="https://www.tiktok.com/tag/videooftheday?refer=embed" rel="noopener">#videooftheday</a> </p>
<p> <a target="_blank" title=" original sound - Terpaling Majikan | Onies - ONIES MAYONIES " href="https://www.tiktok.com/music/original-sound-Terpaling-Majikan-Onies-7209979279713602330?refer=embed" rel="noopener"> original sound &#8211; Terpaling Majikan | Onies &#8211; ONIES MAYONIES </a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502570" name="segment-502570" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Here are other times cats have been rescued from odd situations:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/46094/c380.jpg&quot;);"><a href="https://says.com/my/fun/naughty-cat-got-its-head-stuck-in-a-hole-rescued-by-abang-bomba" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/naughty-cat-got-its-head-stuck-in-a-hole-rescued-by-abang-bomba" class="ga-curator-related">Naughty Cat That Got Its Head Stuck In A Hole Gets Rescued By Abang Bomba</a></h6>
<p>His face is my expression for the whole of 2020.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/62811/038b.jpg&quot;);"><a href="https://says.com/my/news/cat-survives-fall-from-6-storeys-high-car-window-smash-in-thailand" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/cat-survives-fall-from-6-storeys-high-car-window-smash-in-thailand" class="ga-curator-related">Cat Survives Smashing Into Car Window After 6-Storey Fall Without Breaking Any Bones</a></h6>
<p>The cat&#8217;s name is Shifu, like Master Shifu from &#8216;Kung Fu Panda&#8217;.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-502571" name="segment-502571" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Read more cute <a href="https://says.com/my/cat" target="_blank" rel="noopener">#cat</a> stories on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/67697/d5f3.jpg&quot;);"><a href="https://says.com/my/fun/cat-grabs-food-from-under-door" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-grabs-food-from-under-door" class="ga-curator-related">Funny Cat Grabs Food From Under Door Like He&#8217;s Been &#8220;Locked Up In Prison&#8221; For Years</a></h6>
<p>Just black cat things.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66770/01c1.jpg&quot;);"><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day</a></h6>
<p>Cutest thing you&#8217;ll see all year.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66654/cdf1.jpg&quot;);"><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">[VIDEO] M&#8217;sian Shares What Her Dad Is Up To After Retirement &#038; It&#8217;s Super Relatable</a></h6>
<p>It&#8217;s always the Asian parent who didn&#8217;t want a pet.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Oyen Gets Its Head Stuck In A Wall & Is Saved By The Civil Defence Force

<article>
<div class="each-segment">
    <a id="segment-502106" name="segment-502106" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>
<p>
<p><p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>,&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502107" name="segment-502107" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Cats do the darnedest things sometimes and this little black fellow is no exception</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>A <a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830">TikTok</a> posted by Heaven Jirak has been going viral after she showed how her cat gets food from her.</p>
<p>In the video, Heaven is seen putting a plate of cat food on the floor in front of a door. </p>
<p>Before she can even let go of the plate, a black paw slides under the door and quickly grabs the plate from the other side in less than a second.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218967/8306.gif" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218967" alt="" src="https://images.says.com/uploads/story_source/source_image/1218967/8306.gif"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">@heaven.like.the.place (TikTok)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-502111" name="segment-502111" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The video has the Internet in stitches, with many likening the cat&#8217;s antics to that of a prisoner locked away in confinement</h2>
</div>
<div class="segment-body">
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218977/f7e4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218977" alt="" src="https://images.says.com/uploads/story_source/source_image/1218977/f7e4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218978/0390.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218978" alt="" src="https://images.says.com/uploads/story_source/source_image/1218978/0390.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218979/a697.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218979" alt="" src="https://images.says.com/uploads/story_source/source_image/1218979/a697.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218980/80de.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218980" alt="" src="https://images.says.com/uploads/story_source/source_image/1218980/80de.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218981/3ad4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218981" alt="" src="https://images.says.com/uploads/story_source/source_image/1218981/3ad4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218982/6653.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218982" alt="" src="https://images.says.com/uploads/story_source/source_image/1218982/6653.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1218983/e00b.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1218983" alt="" src="https://images.says.com/uploads/story_source/source_image/1218983/e00b.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" rel="noopener">TikTok</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>After one person pointed out that she could imagine the &#8220;jailbird&#8221; just waiting patiently on the other end for his food, Heaven shared a video of the cat&#8217;s point-of-view.</p>
</div>
</div>
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7334440173205310763" data-video-id="7334440173205310763" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>Replying to @Side of Sunny impatiently waiting</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7334440299365780267?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="text">
<div class="">
<p>He indeed waits patiently and immediately snatches the plate from her as soon he hears it coming.</p>
<p>Watch his POV below:﻿</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502120" name="segment-502120" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Heaven revealed that her cat&#8217;s name is Bill and he is one of her four cats at home</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>Speaking to SAYS, she said she got Bill when he was just nine weeks old as a wedding gift from her husband. Bill will turn one next month. </p>
<p>She explained that Bill is &#8220;fed like a solitary inmate&#8221; because he won&#8217;t let her other cats eat, and he sometimes smacks the bowl out of her hands. </p>
<p>So far, this method seems to be effective, as she mentioned that she has tried slow feeders in the past, but Bill would just bite the plastic out of anger. &#8220;He&#8217;s just a little piggy and steals food,&#8221; she added.</p>
<p>Here&#8217;s a close-up of Bill:</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1219004/30b9.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1219004" alt="" src="https://images.says.com/uploads/story_source/source_image/1219004/30b9.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.tiktok.com/@heaven.like.the.place/video/7334085421506366763" rel="noopener">@heaven.like.the.place (TikTok)</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>
</p>
</p>
</p>
</p>
</p>
<p>Bill also often behaves like the &#8216;ultimate youngest child&#8217; by instigating conflicts with the other cats, then crying out for help when faced with consequences, she said, providing a video as proof.</p>
<p>You can watch it below:</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7334776816500002090" data-video-id="7334776816500002090" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>bill is the ultimate youngest child, starts shit then screams for help when there are consequences.</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7334777002487974699?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502112" name="segment-502112" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>As naughty as Bill is though, he does have some tricks up his paw</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7308444701156232491" data-video-id="7308444701156232491" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>we call this one kill bill <a title="catsoftiktok" target="_blank" href="https://www.tiktok.com/tag/catsoftiktok?refer=embed" rel="noopener">#catsoftiktok</a> <a title="cat" target="_blank" href="https://www.tiktok.com/tag/cat?refer=embed" rel="noopener">#cat</a> <a title="britishshorthair" target="_blank" href="https://www.tiktok.com/tag/britishshorthair?refer=embed" rel="noopener">#britishshorthair</a> </p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7308444779703110446?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="text">
<div class="">
<p>When she pretends to hold Bill at &#8216;gunpoint&#8217; with her fingers and &#8216;shoots&#8217;, Bill can flop over as if he has just been shot.</p>
<p>She refers to the trick shot as <i>Kill Bill</i>.&nbsp;</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-502113" name="segment-502113" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Watch the video of how she feeds him below:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<blockquote class="tiktok-embed" cite="https://www.tiktok.com/@heaven.like.the.place/video/7333745089052822830" data-video-id="7333745089052822830" data-embed-from="oembed" style="max-width: 605px;min-width: 325px;" >
<section> <a target="_blank" title="@heaven.like.the.place" href="https://www.tiktok.com/@heaven.like.the.place?refer=embed" rel="noopener">@heaven.like.the.place</a> </p>
<p>this is the easiest way to feed our fouth and craziest cat</p>
<p> <a target="_blank" title=" original sound - Heaven Jirak" href="https://www.tiktok.com/music/original-sound-7333745214325312302?refer=embed" rel="noopener"> original sound &#8211; Heaven Jirak</a> </section>
</blockquote>
<p> <script async src="https://www.tiktok.com/embed.js"></script></div>
</div>
<div class="each-segment">
    <a id="segment-502121" name="segment-502121" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Cat antics will never stop being funny:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66770/01c1.jpg&quot;);"><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/chonky-cat-in-china-add-a-strand-of-noodles-to-its-kibble" class="ga-curator-related">[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day</a></h6>
<p>Cutest thing you&#8217;ll see all year.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/63726/1b55.jpg&quot;);"><a href="https://says.com/my/fun/cat-goes-bald-because-its-friend-keeps-licking-its-head" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-goes-bald-because-its-friend-keeps-licking-its-head" class="ga-curator-related">Cat Goes Bald Because Its Friend Keeps Licking Its Head So Owner Comes Up With Solution</a></h6>
<p>Appropriate solution.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/55920/319c.jpg&quot;);"><a href="https://says.com/my/fun/hilariously-cute-curious-cat-staring-into-its-owner-s-new-cctv" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/hilariously-cute-curious-cat-staring-into-its-owner-s-new-cctv" class="ga-curator-related">Hilariously Cute, &#8216;Kepoh&#8217; Cat Goes Viral For Continuously Staring Into Owner&#8217;s New CCTV</a></h6>
<p>The cutest staredown.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/51246/3201.jpg&quot;);"><a href="https://says.com/my/fun/cat-goes-viral-for-looking-like-dad-who-fall-asleep-on-the-couch" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-goes-viral-for-looking-like-dad-who-fall-asleep-on-the-couch" class="ga-curator-related">Cat Goes Viral For Looking Like A Dad Who Fell Asleep On The Couch</a></h6>
<p>Floof.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/52461/5cc7.jpg&quot;);"><a href="https://says.com/my/fun/malaysian-viral-crochet-cat-hats" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/malaysian-viral-crochet-cat-hats" class="ga-curator-related">Malaysian Crochets And Sells Cat Hats &#038; These Review Photos Are Giving Me Life</a></h6>
<p>The Internet loves them, Bob tolerates them.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


Funny Cat Grabs Food From Under Door Like He's Been "Locked Up In Prison" For Years

Funny Cat Grabs Food From Under Door Like He’s Been “Locked Up In Prison” For Years

<article>
<div class="each-segment">
    <a id="segment-500938" name="segment-500938" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://www.instagram.com/saysdotcom/">Instagram</a>, <a target="_blank" rel="nofollow noopener" href="https://www.tiktok.com/@saysdotcom">TikTok</a>, and <a target="_blank" rel="nofollow noopener" href="https://www.whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a> for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-500939" name="segment-500939" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>A videographer from the UK claimed that he has witnessed a butcher allegedly selling cat meat in Chinatown Kuala Lumpur, prompting many Malaysians to urge authorities to intervene</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>The videographer took to Instagram yesterday, 6 February, to recount his alleged observation of the sale of cat meat.</p>
<p>In the 430-word post, the videographer said he saw <b>people moving in and out of a worn-down doorway</b>, and was curious about the activities behind it.</p>
<p>He noted that the alley did not appear to be a typical spot where tourists would wander. He suggested to his cousin that they investigate what lay behind the door together, but his cousin refused.</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-500940" name="segment-500940" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>&#8220;I decided to go in alone to check what was happening inside,&#8221; he wrote in the caption</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>Inside, he encountered a series of cubicles filled with various items, reminiscent of photos one might find in a National Geographic magazine.</p>
<p>&#8220;I took a few quick snaps and kept moving, until I saw another cubicle with something that caught my eye. I had <b>heard stories that people eat cats, but it&#8217;s always been very difficult to picture it</b>.</p>
<p>&#8220;In front of me, I saw a kitten in a cage with [a] ladle resting on top. At the time, I simply thought, &#8220;Oh cool, probably someone&#8217;s pet&#8217;,&#8221; he said.</p>
<p>The videographer took a few photos and continued walking down the alley.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1216532/3224.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1216532" alt="" src="https://images.says.com/uploads/story_source/source_image/1216532/3224.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://says.com/my" rel="noopener">Instagram</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-500941" name="segment-500941" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>As he walked, he discovered that the place was actually an indoor market, teeming with vendors selling fruits and vegetables, among other things</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>&#8220;Though as I walked in, I immediately felt all eyes [were] watching me, as if I didn&#8217;t belong.</p>
<p>&#8220;The place was grungy, incredibly dirty, and a place I knew you shouldn&#8217;t have come to.</p>
<p>&#8220;As I kept walking, I felt like anything could&#8217;ve happened, and yet I had to take a moment to process what I was seeing,&#8221; he said.</p>
<p>According to the videographer, he saw <b>a meat stall with two cages on the counter, each containing one cat</b>. He also <b>claimed that the butchers were not selling chicken or beef</b>.</p>
<p>&#8220;There was a label on top of the [cages] this time that read, &#8216;<b>Not for Sale. This is my pet. Not for eating</b>&#8216;.</p>
<p>&#8220;I then saw a lady, who was dressed what felt like a Bond villain (she looked very cool, to be frank), go up to the counter, and there, right in front of me, <b>the lady butcher cut up the cat meat</b>.</p>
<p>&#8220;They both then started looking at me, as I tried to discreetly take my last photos. All I knew was that I had to, and wanted to, get out of this place quickly,&#8221; he recounted.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1216533/2be0.jpg" target="" class="imgwrap colorbox-image cboxElement" title="The sign also indicates 'nicht zu verkaufen', which translates to 'not for sale' in German." rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1216533" alt="The sign also indicates 'nicht zu verkaufen', which translates to 'not for sale' in German." src="https://images.says.com/uploads/story_source/source_image/1216533/2be0.jpg"> </a>
                </div>
<p class="img-caption">The sign also indicates &#8216;nicht zu verkaufen&#8217;, which translates to &#8216;not for sale&#8217; in German.</p>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://says.com/my" rel="noopener">Instagram</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1216534/fe73.jpg" target="" class="imgwrap colorbox-image cboxElement" title="The door that the videographer exited from." rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1216534" alt="The door that the videographer exited from." src="https://images.says.com/uploads/story_source/source_image/1216534/fe73.jpg"> </a>
                </div>
<p class="img-caption">The door that the videographer exited from.</p>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://says.com/my" rel="noopener">Instagram</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-500942" name="segment-500942" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>At the time of writing, the videographer&#8217;s post has garnered over 7,200 likes and 300 comments</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>Netizens expressed horror at the alleged sale of cat meat in Petaling Street, with many of them urging the Royal Malaysia Police (PDRM) and the Kuala Lumpur City Hall (DBKL) to take action.</p>
<p>&#8220;Wait, I am [a] Malaysian and I didn&#8217;t know that this exists? What? OMG!&#8221; read a top comment. </p>
<p>Celebrities, such as Nadia Aqilah and Yaya Zahir, also commented on the post.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1216522/202c.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1216522" alt="" src="https://images.says.com/uploads/story_source/source_image/1216522/202c.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://says.com/my" rel="noopener">Instagram</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>SAYS has reached out to the videographer and DBKL for further details regarding the incident, but did not immediately receive a response.﻿</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-500943" name="segment-500943" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Although the videographer&#8217;s allegation may come as a shock to many, incidents of individuals selling cat meat in Malaysia are not unheard of</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>In 2017, <a target="_blank" rel="nofollow noopener" href="https://www.pressreader.com/malaysia/harian-metro/20170525/281578060607823">Harian Metro</a> published an article highlighting the presence of the cat meat market in Malaysia, particularly among Vietnamese foreign workers.</p>
<p>In 2019,&nbsp;<a target="_blank" rel="nofollow noopener" href="https://www.nst.com.my/opinion/letters/2019/05/487633/there-no-place-malaysia-consumption-dog-and-cat-meat#google_vignette">New Straits Times</a>&nbsp;also reported, citing an environmental rights group, about the prevalence of the cat and dog meat trade in Malaysia among foreign workers.</p>
<p>The existing legislation in Malaysia does not explicitly prohibit the trade or consumption of dog and cat meat, a matter that animal rights groups have been advocating to criminalise for more than a decade.</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</p>
</div>
</div>
<div class="each-segment">
    <a id="segment-500949" name="segment-500949" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Catch up on the latest news on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://cms.says.com/wp-content/uploads/2024/02/2dec.jpg&quot;);"><a href="https://says.com/my/news/free-toll-on-thursday-and-friday-for-chinese-new-year" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/free-toll-on-thursday-and-friday-for-chinese-new-year" class="ga-curator-related">Free Toll On 8 And 9 February For Chinese New Year</a></h6>
<p>The toll exemptions will be implemented at numerous toll plazas, starting from 12.01am on 8 February.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://cms.says.com/wp-content/uploads/2024/02/a85f.png&quot;);"><a href="https://says.com/my/news/ukraine-born-model-miss-japan-affair-scandal" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/ukraine-born-model-miss-japan-affair-scandal" class="ga-curator-related">Ukraine-Born Model Who Won Ms Japan Resigns After Tabloids Reveal Affair With Married Man</a></h6>
<p>The man has yet to comment publicly.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://cms.says.com/wp-content/uploads/2024/02/f54f.png&quot;);"><a href="https://says.com/my/news/education-ministry-to-investigate-claims-on-leaked-spm-history-paper" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/news/education-ministry-to-investigate-claims-on-leaked-spm-history-paper" class="ga-curator-related">Education Ministry To Investigate Leaked SPM History Paper Claims</a></h6>
<p>Education Minister Fadhlina Sidek has urged SPM candidates to focus on the remaining exam papers.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


UK Videographer Claims Cat Meat Is Being Sold In Hidden Alley In Chinatown KL

<article>
<div class="each-segment">
    <a id="segment-494930" name="segment-494930" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2></h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><i>Follow us on <a target="_blank" rel="nofollow noopener" href="https://instagram.com/saysdotcom">Instagram</a>, <a target="_blank" rel="nofollow noopener" href="https://tiktok.com/@saysdotcom">TikTok</a>, and <a target="_blank" rel="nofollow noopener" href="https://whatsapp.com/channel/0029VZzynzi6RGJG0QbRfy3O">WhatsApp</a>&nbsp;for the latest stories and breaking news.</i></p>
</div>
</div>
<div class="each-segment">
    <a id="segment-494957" name="segment-494957" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>A chonky cat in China is stealing hearts for visiting a noodle shop to get a strand of noodles to eat with his kibble every day.</p>
<p>And he is adorably named Popsicle.</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>His equally adorable routine is posted on Douyin daily by his owner under the handle <a target="_blank" rel="nofollow noopener" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB">@槟榔石榴爱冰棍</a>.</p>
<p>The account is named after the owner&#8217;s three cats: Betel Nut (槟榔), Pomegranate (石榴), and Popsicle (冰棍), but <b>it is Popsicle that always steals the limelight.</b></p>
</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204463/2e4c.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204463" alt="" src="https://images.says.com/uploads/story_source/source_image/1204463/2e4c.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB" rel="noopener">@槟榔石榴爱冰棍 (Douyin)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-495003" name="segment-495003" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>The endearing videos always show Popsicle running excitedly from his home across the street to get noodles for &#8216;takeout&#8217;</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p><p>The owner shares that the shop lady always reserves a strand for him for breakfast, and he sometimes even returns for another strand at lunch.</p>
<p>One of their most viral videos shows how Popsicle masterfully takes the noodle strand from the shop owner with his mouth, and carefully holds it while<b>&nbsp;happily trotting back home to put it into his bowl.</b></p>
<p><b></b>Popsicle&#8217;s owner said he never takes a bite on the way home and enjoys eating the noodle with the other food in his bowl.</p>
<p><b></b></p>
</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204439/630c.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204439" alt="" src="https://images.says.com/uploads/story_source/source_image/1204439/630c.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB" rel="noopener">@槟榔石榴爱冰棍 (Douyin)</a></small>
            </div>
</p></div>
</p></div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204464/d46f.jpg" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204464" alt="" src="https://images.says.com/uploads/story_source/source_image/1204464/d46f.jpg"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB" rel="noopener">@槟榔石榴爱冰棍 (Douyin)</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-495004" name="segment-495004" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Popsicle&#8217;s routine has gained over hundreds of thousands of views, with tonnes of netizens admiring the little cat&#8217;s independent runs for noodles</h2>
</div>
<div class="segment-body">
<div class="text">
<div class="">
<p>&#8220;I don&#8217;t understand why Popsicle must go home and put the noodle in his bowl before eating it,&#8221; commented an amused Douyin user.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204442/b1fe.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204442" alt="" src="https://images.says.com/uploads/story_source/source_image/1204442/b1fe.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB?relation=0&#038;vid=7310951397158079779" rel="noopener">Douyin</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>&#8220;His tummy is almost touching the floor,&#8221; laughed another.</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204444/839d.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204444" alt="" src="https://images.says.com/uploads/story_source/source_image/1204444/839d.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB?relation=0&#038;vid=7310951397158079779" rel="noopener">Douyin</a></small>
            </div>
</p></div>
</p></div>
<div class="text">
<div class="">
<p>While another said, &#8220;He must have eaten one too many noodles to get that chonky.&#8221;</p>
</div>
</div>
<div class="image">
<div class="">
<div class="single-image list-unstyled">
<div class="single-image-wrap">
                    <a href="https://images.says.com/uploads/story_source/source_image/1204446/c9d4.png" target="" class="imgwrap colorbox-image cboxElement" title="" rel="segment-810 noopener"><br />
                      <img decoding="async" class="source-img-1204446" alt="" src="https://images.says.com/uploads/story_source/source_image/1204446/c9d4.png"> </a>
                </div>
<p>                <small class="img-credit">Image via <a target="_blank" href="https://www.douyin.com/user/MS4wLjABAAAAtfdamMPjo8q_dz3XbHQLbA9prDlaidSwv85Dr7VYGR8azMA4lE0Bpivshw8vl8sB?relation=0&#038;vid=7310951397158079779" rel="noopener">Douyin</a></small>
            </div>
</p></div>
</p></div>
<div class="each-segment">
    <a id="segment-494966" name="segment-494966" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Watch one of Popsicle&#8217;s noodle run videos here:</h2>
</div>
<div class="segment-body">
<div class="embed">
<div class="fitvidWrapper">
<div style="position:relative; width:100%; height:0px; padding-bottom:177.778%"><iframe loading="lazy" allow="fullscreen" allowfullscreen height="100%" src="https://streamable.com/e/mvw5jd?nocontrols=1" width="100%" style="border:none; width:100%; height:100%; position:absolute; left:0px; top:0px; overflow:hidden;"></iframe></div>
</div>
</div>
<div class="each-segment">
    <a id="segment-494967" name="segment-494967" class="segment-anchor"></a></p>
<div class="banner-wrap d-lg-block d-none">
</div>
<div class="segment-head">
<h2>Read more cute <a href="https://says.com/my/stories/tagged/cats" target="_blank" rel="noopener">#cat</a> stories on SAYS:</h2>
</div>
<div class="segment-body">
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/66654/cdf1.jpg&quot;);"><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/video-msian-shows-her-retired-dad-dressing-their-cat-up-to-take-photos" class="ga-curator-related">[VIDEO] M&#8217;sian Shares What Her Dad Is Up To After Retirement &#038; It&#8217;s Super Relatable</a></h6>
<p>It&#8217;s always the Asian parent who didn&#8217;t want a pet.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/65854/dd86.jpg&quot;);"><a href="https://says.com/my/lifestyle/cat-beach-in-penang-where-300-cats-roam-freely-can-be-adopted" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/lifestyle/cat-beach-in-penang-where-300-cats-roam-freely-can-be-adopted" class="ga-curator-related">There&#8217;s A Cat Beach In Penang Where 300 Adorable Kitties Roam Freely &#038; Can Be Adopted</a></h6>
<p>A cat lover&#8217;s paradise. :&#8217;)</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/64652/74d9.png&quot;);"><a href="https://says.com/my/fun/cat-blocks-exit-gate-lrt-station" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/cat-blocks-exit-gate-lrt-station" class="ga-curator-related">&#8220;Chief Meow&#8221; — Cat Leisurely Sits On &#038; Blocks Exit Gate Scanner At LRT Station</a></h6>
<p>&#8220;The cat&#8217;s making sure the card gets tapped,&#8221; wrote one commenter.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
<div class="related-source source-related">
<div>
<div class="related-thumb" style="padding-bottom: 10px">
<div class="aspect-ratio-says" style="background-image: url(&quot;https://images.says.com/uploads/story/cover_image/62302/f64e.jpg&quot;);"><a href="https://says.com/my/fun/woman-dresses-her-61-cats-in-matching-outfits-for-hari-raya" class="ga-curator-related">&nbsp;</a></div>
</div>
<div class="related-content">
<h6><a href="https://says.com/my/fun/woman-dresses-her-61-cats-in-matching-outfits-for-hari-raya" class="ga-curator-related">Penang Woman Dresses Her 61 Cats In Matching Outfits For Hari Raya</a></h6>
<p>Matchy-matchy.</p>
</div>
<div class="related-content"><span class="meta-domain pull-left"><img decoding="async" src="https://says.com/favicon-16x16.png"></span><span class="meta-domain pull-right">Read the full story<i class="icon-angle-right"></i></span></div>
</div>
</div>
</div>
</div>
</article>


[VIDEO] Chonky Cat In China Visits Shop To Add A Strand Of Noodles To His Kibble Every Day